KEGG   Desulfotalea psychrophila: DPPB20Help
Entry
DPPB20            CDS       T00192                                 

Definition
(GenBank) probable conjugal transfer protein TrbI
  KO
K20533  type IV secretion system protein TrbI
Organism
dps  Desulfotalea psychrophila
Pathway
dps02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:dps00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    DPPB20
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:dps02044]
    DPPB20
Secretion system [BR:dps02044]
 Type IV secretion system
  Trb secretion system protein
   DPPB20
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbI
Motif
Other DBs
NCBI-ProteinID: CAG37884
UniProt: Q6AIG3
Position
large:21388..22635
Genome map
AA seq 415 aa AA seqDB search
MSDNPTGLKPTPQGTWLSKKPLFFAATVGAIMLLIMLYSINGNKKVEREAEQSVVTIETT
EEQTKADYGVASLPTPPNEAGTIRAAKSTAAPLLPAKPITVITQRQKTQVEIQHEKELAK
VREWKITNQLKALNSPLIEKKITGNESNFSSTLPSTPSASTSGGGGANARFDQLKNQLAK
VQNGSATPAQPLKSSSGLTSKPSQWTSQYTREAGAQFELKTGTVIPALMLTGINSQLAGE
ITGQVSQNIYDTATGQYLIIPQGTRISGNYASDVQVGQERLFVVWKRLVFPDGSSVTLDG
LQGVDYAGYTGLKDQVDNHYAKIFGNAIVMSLITGGSAYAIDSLNDNGNNDDRNRRITIQ
SELGTAVATQLSQTGLALLQRNMNIAPTIKIRPGYRFNVMVVKDMVFDEPYEGWR
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacaacccaactggcctcaagcctacgccacaaggcacttggcttagtaaaaaa
ccacttttttttgctgctactgttggagccataatgcttctcattatgctgtactccatc
aacggaaacaaaaaagtagagcgcgaggccgagcaatctgtagttacgattgaaacaaca
gaagagcaaacaaaagcagattacggggtagcgtcattacctaccccaccaaacgaagcg
ggaacaatcagggctgctaaatctacagctgcaccactgttaccagcaaaaccgataacc
gttataacccagagacaaaaaacacaggtcgaaattcagcatgaaaaagaactggcaaaa
gttagagagtggaagattaccaatcaactcaaggcacttaattctccgctgatcgagaaa
aaaataacaggaaatgaatcaaatttcagctcaactcttccatctactccatcggcctcg
acctcgggtggtggcggtgctaatgcaagatttgaccagttaaaaaatcagcttgcgaaa
gtgcagaatggttcggcaacacctgctcaaccactaaaaagctcatcgggtttaacctca
aaaccatcacaatggacatctcagtatacgagggaggcaggagcacaatttgagctaaaa
acaggtacggtaatccccgccctaatgctcactggtatcaactcgcaacttgccggcgaa
attacgggccaggtatcgcaaaatatttacgacacggccacaggccagtatctcataatc
ccccagggaaccaggatttccggcaactacgcttccgatgtccaggtgggccaggaacga
cttttcgtcgtttggaaaagactcgtcttccctgacggctcaagcgttaccctcgacggc
ttacagggcgttgactatgcgggatacactggacttaaagatcaagttgacaatcattat
gccaagatttttggcaatgccattgttatgtcgcttatcaccgggggatcggcatatgcc
attgatagcctaaatgataatggaaacaacgatgaccgtaatcgtcgcatcactatacag
agcgagcttggaacagcagtagcaactcaactcagccaaacgggtttggcattgttacag
cgcaatatgaacattgcgcccactatcaagattcgacccgggtaccgctttaatgtgatg
gttgtaaaagacatggttttcgatgaaccctacgagggatggagatag

DBGET integrated database retrieval system