KEGG   Deinococcus proteolyticus: Deipr_0924Help
Entry
Deipr_0924        CDS       T01426                                 

Definition
(GenBank) Phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
dpt  Deinococcus proteolyticus
Pathway
dpt00010  Glycolysis / Gluconeogenesis
dpt00020  Citrate cycle (TCA cycle)
dpt00620  Pyruvate metabolism
dpt01100  Metabolic pathways
dpt01110  Biosynthesis of secondary metabolites
dpt01120  Microbial metabolism in diverse environments
dpt01130  Biosynthesis of antibiotics
dpt01200  Carbon metabolism
Module
dpt_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:dpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Deipr_0924
   00020 Citrate cycle (TCA cycle)
    Deipr_0924
   00620 Pyruvate metabolism
    Deipr_0924
Enzymes [BR:dpt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     Deipr_0924
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: ADY26080
UniProt: F0RMT8
Position
complement(975976..977553)
Genome map
AA seq 525 aa AA seqDB search
MTATPSRISSLLQSAQVHRNPTVPELYEHALRLGEGQIAQGGPLAVRTNKAGRSPKDRFI
VEDELTRDTVWWQGFNQPISAEVFDRLLAKMLDYAQNKELFVQELYAGTDPEQRISVRFI
QEMAYHSLFVNNMFVRPSAAERQNFEADWTVLNIPSFTADPEVDGTRTDTFILVNFKEKM
IIAGGTQYAGENKKGIFGVLNFLLPERGVMPMHCSANVGEGGDVALFFGLSGTGKTTLSA
DPSRRLIGDDEHGWTDSGVFNFEGGCYAKVINLNAEAEPAIYRTTHTYGTVLENVVLDEN
RIPDLDDGSLTENTRSAYPIEQIDNIQPGSIAGHPKNVVFLTADAFGVLPPISKLTPEQM
EYQFISGFTAKIPGTEQGVTEPQPTFSTCFGAPFMPRHPGEYAELLARKVKEHGSAVWLV
NTGWTGGQYGTGKRMSIRHTRAMINAALDGQLDDVEFETEPFFGLSIPKEVPGVPAEVLN
PREAWADKAAYDETAKKLAGMFRENFKRFEEGVRPEVTASMPEHA
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atgactgcaaccccatcccgtatcagcagcctgcttcagtccgcgcaggtgcaccgcaac
cccaccgtgcccgagctgtacgaacatgccctgcgcctgggcgaaggccagattgcccag
ggtggtcccctggccgtccgtaccaataaggctggccgtagccccaaggaccgcttcatc
gtggaagacgagctgacccgcgacacggtgtggtggcagggcttcaaccagcccatcagt
gcggaagtgttcgaccgcctgctggcgaagatgctggactacgcccagaacaaggaactg
ttcgtgcaggagctgtacgccggcaccgaccccgagcagcgcatttcggtacggttcatt
caggagatggcgtaccactcgctgttcgtgaacaacatgttcgtgcgccccagtgccgcg
gagcgccagaacttcgaagccgactggaccgtgctgaacattcccagcttcactgctgac
cccgaagtggacggcacccgcaccgacacgtttatcctggtgaacttcaaggagaagatg
attatcgcgggcggcacccagtatgccggcgagaacaaaaagggcatcttcggcgtgctg
aacttcctgctgcccgaacgcggcgtgatgccgatgcactgctcggccaacgtgggcgag
ggcggcgacgtggcgctgttcttcggcctgagcggcaccggcaagaccaccctgagcgcc
gaccccagccgccggctgattggcgacgacgagcacggctggaccgacagcggcgtgttt
aacttcgagggcggctgctacgccaaggtcatcaacctgaatgccgaagccgagccggcc
atctaccgcaccacccacacctacggcaccgtgctggagaacgtggtgctggacgagaac
cgcatccccgacctcgacgacggttctctcaccgagaacacccgcagcgcctaccccatc
gagcagattgacaacattcagcctggctcgattgccggccaccccaagaacgtggtattc
ctgaccgccgacgccttcggcgtgctgccccctatctccaagctgaccccggagcagatg
gaataccagttcatcagcggctttaccgccaagattcccggcaccgagcagggcgtgacc
gagccgcagcccaccttcagcacctgcttcggcgcgcccttcatgccccgccaccccggc
gagtacgccgagctgctggcccgcaaggtcaaggagcacggctcggccgtgtggctggtc
aacaccggctggaccggcggccagtacggcaccggcaagcgcatgagcatccggcacacc
cgcgccatgattaacgccgcgctcgacggccagctggacgatgtggaatttgagaccgag
cctttcttcggcctgagcattcccaaggaagtgcccggcgtgcctgccgaagtgctgaac
ccccgcgaagcctgggccgacaaggccgcctacgacgaaaccgcgaagaagctggccgga
atgttccgcgagaacttcaagcgctttgaagaaggcgtgcgtcctgaagtgacggcgtcc
atgcctgagcacgcttaa

DBGET integrated database retrieval system