KEGG   Deinococcus proteolyticus: Deipr_0996Help
Entry
Deipr_0996        CDS       T01426                                 

Definition
(GenBank) succinate dehydrogenase cytochrome b subunit
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
dpt  Deinococcus proteolyticus
Pathway
dpt00020  Citrate cycle (TCA cycle)
dpt00190  Oxidative phosphorylation
dpt00650  Butanoate metabolism
dpt01100  Metabolic pathways
dpt01110  Biosynthesis of secondary metabolites
dpt01120  Microbial metabolism in diverse environments
dpt01130  Biosynthesis of antibiotics
dpt01200  Carbon metabolism
Module
dpt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
dpt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
dpt_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:dpt00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Deipr_0996
   00650 Butanoate metabolism
    Deipr_0996
  Energy metabolism
   00190 Oxidative phosphorylation
    Deipr_0996
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_D VirB8 DUF4870
Motif
Other DBs
NCBI-ProteinID: ADY26152
UniProt: F0RN10
Position
complement(1048900..1049277)
Genome map
AA seq 125 aa AA seqDB search
MTRARTLMDARAQSHTNAELNWWIFMRVSGLILIFLVLGHIYMTFIQVSESDATYHAVVA
KLSNPAWKLYDWLILTLTMLHGMNGARYVMEDYIRSNPNRAWVKMVVFSIAALIYALGTV
GLFSI
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgacccgcgcacgcaccctgatggacgcccgcgcccagtcgcacaccaacgccgagctg
aactggtggattttcatgcgggtcagcggtctgattctgattttcctggtgctgggtcac
atctacatgacctttatccaggtgtccgaatccgacgccacctatcatgccgtagtggcc
aagctgagcaaccccgcctggaagctgtacgactggctgattctgaccctgaccatgctg
cacggcatgaacggcgcacgttatgtcatggaagactacatccgctccaaccccaaccgg
gcctgggtcaagatggtggttttttccatcgctgcgctgatttacgccctgggcaccgtg
ggcctgttttccatctga

DBGET integrated database retrieval system