KEGG   Dermatophagoides pteronyssinus (European house dust mite): 113788967Help
Entry
113788967         CDS       T05775                                 

Definition
(RefSeq) heat shock cognate 71 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
dpte  Dermatophagoides pteronyssinus (European house dust mite)
Pathway
dpte03040  Spliceosome
dpte04141  Protein processing in endoplasmic reticulum
dpte04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:dpte00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    113788967
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113788967
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    113788967
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpte01009]
    113788967
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dpte03041]
    113788967
   03009 Ribosome biogenesis [BR:dpte03009]
    113788967
   03110 Chaperones and folding catalysts [BR:dpte03110]
    113788967
   04131 Membrane trafficking [BR:dpte04131]
    113788967
   03051 Proteasome [BR:dpte03051]
    113788967
   03029 Mitochondrial biogenesis [BR:dpte03029]
    113788967
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpte04147]
    113788967
Protein phosphatases and associated proteins [BR:dpte01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     113788967
Spliceosome [BR:dpte03041]
 Complex B
  Other components
   Prp19 complex
    113788967
 Complex C
   Prp19-CDC5 complex
    113788967
Ribosome biogenesis [BR:dpte03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    113788967
Chaperones and folding catalysts [BR:dpte03110]
 Heat shock proteins
  HSP70 / DNAK
   113788967
Membrane trafficking [BR:dpte04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    113788967
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    113788967
Proteasome [BR:dpte03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    113788967
Mitochondrial biogenesis [BR:dpte03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    113788967
Exosome [BR:dpte04147]
 Exosomal proteins
  Proteins found in most exosomes
   113788967
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR Hydantoinase_A DUF1464 MetOD2
Motif
Other DBs
NCBI-GeneID: 113788967
NCBI-ProteinID: XP_027194247
Position
Unknown
AA seq 644 aa AA seqDB search
MSKAPAIGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPSNTVFDAKRLIGRRFDDPSVQSDMKFWPFKVVNEGGKPKIEVDYKGEVKRFFPEEIS
SMVLIKMKEIAEAYLGKKVTDAVITVPAYFNDSQRQATKDAGAIAGLNVLRIINEPTAAA
IAYGLDKKGGEKNVLIFDLGGGTFDVSILSIDNGVFEVKSTAGDTHLGGEDFDNRLVNHF
IQEFKRKYSKDMSANKRAVRRLRTACERAKRTLSSSTQSTVEIDSLYEGIDFHSTITRAR
FEELCSDLFRSTLEPVEKAMRDAKLDKSKIDEIVLVGGSTRIPKIQKLLTDYFNGKDLNK
SINPDEAVAYGAAVQAAILTGDTSKNVQDLLLLDVAPLSLGIETAGGVMTALIKRNTTIP
TKQTQIFTTYADNQPGVTIKVYEGERAMTKDNNLLGTFDLNGIPPAPRGIPQIEVTFDID
ANGILNVSAVDKSTGKQNKITITNDKGRLSKDDIERMVQEAEKYREEDERQQARIQAKNS
LESYAFQMKNSIEDDAIKSKISDSDRTTISNKIKDVLNWLDNNQLAEKDEFEDRQKELEQ
ICRPIISKLYQGAGGPGGPGGFPGGASTHGGGGSNSGPTVEEVD
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaagcacctgcgattggtattgatttgggcacaacttattcttgtgtcggtgtt
tttcaacatggtaaagtagaaattatcgctaatgatcaaggtaatcgaacaacaccaagt
tatgttgcttttaccgatacggaacgtttgattggtgatgcggctaaaaatcaagtggct
atgaatccatcgaacactgtgttcgatgctaaacgtttaattggtcgacgttttgatgat
ccatctgttcaatctgatatgaaattctggccatttaaagtggttaatgaaggtggaaaa
ccaaaaatcgaagttgattataaaggtgaagtgaaacgattcttccccgaagaaatttct
tcaatggtattgatcaaaatgaaagaaattgccgaagcatacctaggtaaaaaagttacc
gatgctgtcatcactgtaccagcttatttcaatgattcacaacgtcaagctaccaaagat
gctggtgctattgccggtttaaatgttcttcgtattatcaatgaacctacagctgctgct
attgcatatggtttagataaaaaaggtggtgaaaaaaatgtattgattttcgatcttggt
ggtggtacattcgatgtatcaattttgtcaatcgataatggtgtatttgaggtcaaatca
actgcaggcgatacacatctaggtggtgaagattttgataatcgtcttgttaatcatttt
attcaagaatttaaacgtaaatattctaaagatatgtcggcaaataaacgtgcagtacgt
cgtcttcgtaccgcttgtgaacgtgcaaaacgtacattatcatcatcaacacaatcaaca
gtcgaaatcgattcattatatgaaggtattgattttcattcaacaataacacgtgcacgt
tttgaagaattatgttcggatttattccgttcaacattggaaccagtggaaaaagctatg
cgcgatgctaaattggataaatcaaaaattgatgaaatcgtattggtcggtggttcaaca
cgtattccaaaaatacagaaattacttactgattactttaatggaaaagatttaaacaaa
tcgattaatccggatgaagccgttgcatatggtgcagcagtacaggctgctattttgact
ggtgatacatcaaaaaatgtccaggatttacttctgctggatgttgcaccattatcgttg
ggtattgaaactgctggaggtgtaatgacagcattgatcaaacgtaatacaaccatacca
acgaaacaaacacaaatattcaccacctacgccgataatcaaccgggtgttacaattaaa
gtatatgaaggtgaacgtgccatgaccaaggataataacttattgggtacattcgatttg
aatggaattccacctgcacctcgtggtattccacaaattgaagttacatttgatattgat
gccaacggtatattgaatgtatcggctgtggataaaagtactggtaaacagaataagatc
actattacgaatgacaaaggtcgtttatcgaaagatgatatcgaacgtatggtacaagaa
gctgaaaaatatcgtgaagaagatgaacgacaacaagctagaattcaggctaaaaattca
ttagaatcatatgcatttcaaatgaaaaattctatcgaagatgatgccatcaaatcaaaa
atatccgattctgatcgaacaaccatttcaaataaaatcaaagatgtactaaactggcta
gataataatcaattagccgaaaaagatgaatttgaagatagacaaaaagaattggaacaa
atctgtcgacctatcatctcgaaattgtatcaaggtgcaggtggtccaggaggtcccggt
ggtttcccgggtggtgcatcaactcatggtggtggtggttctaatagtggcccaacagta
gaagaagtagattaa

DBGET integrated database retrieval system