KEGG   Dermatophagoides pteronyssinus (European house dust mite): 113789322Help
Entry
113789322         CDS       T05775                                 

Definition
(RefSeq) probable arginine--tRNA ligase, mitochondrial
  KO
K01887  arginyl-tRNA synthetase [EC:6.1.1.19]
Organism
dpte  Dermatophagoides pteronyssinus (European house dust mite)
Pathway
dpte00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:dpte00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    113789322
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dpte01007]
    113789322
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dpte03016]
    113789322
   03029 Mitochondrial biogenesis [BR:dpte03029]
    113789322
Enzymes [BR:dpte01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.19  arginine---tRNA ligase
     113789322
Amino acid related enzymes [BR:dpte01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   113789322
Transfer RNA biogenesis [BR:dpte03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    113789322
 Prokaryotic type
   Other AARSs
    113789322
Mitochondrial biogenesis [BR:dpte03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    113789322
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1d DALR_1 EIAV_GP90 Cas6_N AvrM-A YodL
Motif
Other DBs
NCBI-GeneID: 113789322
NCBI-ProteinID: XP_027194641
Position
Unknown
AA seq 480 aa AA seqDB search
MDLIVEHQLNGGKKKIIVEYSSPNIAKPFHVGNLRSTIIGNSIANILEFYGNNVIRMNYL
GDWGTQFGILSLAYDQFGDPNKLQCEPLKHLFNVYVDGNRKCDSDIDWRNQAKNRFYQLE
TNDSRIYEQWYEFRRLSIDELEKLYKRLGIQFDRYESESMYSQSINDIIQMIQQQKLIKI
IDGATCIEIDDPNQKNKKLAIPLLKNDGTSLYLTRDLAAVINRQKHYNFDQMYYVVDSSQ
SKHFNNLKNIFHSLNNPVYRNLEHLKFGRILGMSTRKGEAIFLDDVLNEAKHRSLEAIKT
SQNTKIPIEQYEPIADILGVSAIIVNDLSNRRVSEYRFNWNRALRMNGNTGISLQYTHAR
LCNLIKKSTNNDDDYDDYQCSSSSLSLNLAAIDTLEGRSLINQLLMFDEIIDQSYDQLEP
SILTNYMFDLKTAINRANQELTIKGQPKSIQQTRLLLFICAKNVLNQCMRLIGLQPLESM
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggatttgattgttgaacatcaattaaatggtggtaaaaagaaaattattgttgaatat
tcatcaccaaatattgcaaaaccatttcatgttggaaatttacgttcaacaataattggt
aatagtattgcaaatatattggaattttatggaaataatgttatacgaatgaattatctt
ggtgattggggtacacaattcggtatattaagtcttgcatatgatcaatttggtgatcca
aacaagctacaatgtgaaccattaaaacatttattcaatgtttatgttgatggtaatcga
aaatgtgattcggatattgattggagaaatcaggctaaaaatcgtttctatcaattggaa
acaaatgattccagaatctatgaacaatggtatgaatttcgtcgattaagtattgatgaa
ttggaaaaattatataaaagattaggtattcaatttgatcgatatgaaagtgaatcaatg
tatagtcaatcaataaatgatataatccagatgattcaacaacaaaaattaatcaaaatt
attgatggtgcaacatgtatcgaaattgatgatccaaatcagaagaataaaaaattagct
ataccattattgaaaaatgatggtacaagtctttatctaactagagatttagccgcagtt
ataaatcgacaaaaacattataattttgatcaaatgtattatgttgtcgatagtagtcaa
tcaaaacattttaataatttgaaaaatatttttcattcattgaataatcctgtttatcga
aatcttgaacatttgaaattcggacgaatattaggaatgagtacacgtaaaggtgaagca
atttttcttgatgatgtactaaatgaagctaaacatcgttcattggaagcaataaaaact
agtcaaaacacaaaaattccaattgaacaatatgaaccgattgctgatatattgggtgtt
tcagctatcattgtaaatgatttatcaaatcgtcgtgtatctgaatatcgattcaattgg
aatcgtgcacttcgaatgaatggaaatacaggaatttctttacaatatacacatgcaaga
ttatgtaatttgattaaaaaatctacaaataacgatgatgattatgatgattatcaatgt
tcatcatcatcattatcattgaatttggctgctatcgatactttggaaggtcgaagtcta
atcaatcaattattaatgtttgatgaaataatcgatcaatcttatgatcaactagaacca
agtatattaaccaattatatgtttgatcttaaaacggctataaatcgtgctaatcaagaa
ttaacaatcaaaggacaaccgaaatcaattcaacaaacacgtttattattgtttatctgt
gctaaaaatgtactaaatcaatgtatgcgattaattggtttacaaccattagaatcaatg
tga

DBGET integrated database retrieval system