KEGG   Dermatophagoides pteronyssinus (European house dust mite): 113789974Help
Entry
113789974         CDS       T05775                                 

Definition
(RefSeq) guanylate cyclase 32E-like
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
dpte  Dermatophagoides pteronyssinus (European house dust mite)
Pathway
dpte00230  Purine metabolism
dpte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpte00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    113789974
Enzymes [BR:dpte01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     113789974
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase Peripla_BP_6 HNOBA Cas9-BH CAP59_mtransfer
Motif
Other DBs
NCBI-GeneID: 113789974
NCBI-ProteinID: XP_027195379
Position
Unknown
AA seq 1062 aa AA seqDB search
MMMMNIIIIILLSITPGLVVTCSPVVLTTNNTTIRIGFLSSFRYGLGKIIAGAVPLAIKD
LNSDDSILPNHNIDFIAAEFGKPNSYSGIRKMTELKDRVHAFIGPDESCACEALVASAWN
KPIVSYKCIDQNLSNKTIYPTFARTLPPSSKISKSVISLLKHFKWNKVVLIVSKNPSNQQ
VQESLMKLANEQQIQIRQKYYLPDQYISRHEQEIEQIIDNSYQQTRIYILLTDTFVLVDF
IRLMQRKKLLDTGLYAIVSVEEEVFYSVKKGGYLNKQYKNLRNLDHLDLRGLMIITPSPP
LNMNYSEFQKDVLEYNRRDPFSIPFHKKIAIQVPIYGGLLYDAVTVIAQAFHKVIENGQN
ISNGIIVMDALKNLNYKSILGFNVHMDENGDAEGNYTLLCLDIVNKSIDMQIVGSFHQTE
NDLPVLKLNRKLKWYGNGPILSEPICGFNNEFCDNVTIIIGIILFIIIFITIVFFTFKHY
HYEYKLTKVLWKIDIKDILFIHTDFEYGLQNIRNTINLHSLKQMEVVFNTNNIQNKNEQF
ENSSIDIFDNQLYGIAIYKGSITFVKRICKKSIDLTRNIRKELIQMREMRHENINQFIGA
IIDAPNIAVMFIYCARGNLEDVLRNKDINLDNMFVASLVADLIKGMIYLHDSDIISHGNL
KPSNCLIDSRWVLQISDYGLHEFKSTQDLFKSKENQEKDMLWRAPELLKNLNASPRGSQK
GDVYSFALILYEIILRKNPYEEINMSNNEILHRIINPKLYGEVFRPRLKKLKCSQYIIKC
IEECWKEEPDERPDFRFINIRLREMQAGLKPNIFDNMIAMLEKYSYNLESLVQERTIQLL
EEKKKTENLLLRMLPKSAAEQLKRGEAVEAEYFDCVTIYFSDIVGFTELSAMSTPIQVVN
LLNDLYTCFDSIIGNYDVYKVETIGDAYMVVSGLPIRNAEKHAGQIASMALHLLQEIFNF
EIAHRPGEYLKLRIGIHSGPCVAGVVGLKMPRYCLFGDTVNVASRMESTGEAHKIHVSYS
CKQILDKLDGYILEERGLISIKGKGQMRTYWLLDRNLSDDSL
NT seq 3189 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgatgaacattattattattattttgttatcgattacacctggattagtggtc
acttgttcacctgttgtattgacgacaaacaatactacaatacgtattggttttctaagt
tcatttcgttatggtttaggtaaaattattgccggtgctgtaccattagccattaaagat
ttgaatagtgatgattctattcttcctaatcataatatcgattttattgctgctgaattt
ggtaaaccaaacagttattccggtatacgaaaaatgaccgaattaaaagatcgtgttcat
gcttttattggaccggatgaaagttgtgcttgtgaagcattagtcgcttcggcttggaat
aaaccaatcgtttcatataaatgtatcgatcaaaatctatcgaataaaacaatttatcca
acatttgctcgtacattaccgccaagttcaaaaatttccaaatcagtcatatctttattg
aaacatttcaaatggaataaagtcgtattgattgtatcaaaaaatccatccaatcaacaa
gtacaagaatcactgatgaaattagccaatgaacaacaaatacaaatacgacaaaaatat
tatctacctgatcaatatattagccgtcatgaacaagaaatcgaacaaatcattgataat
agttatcaacaaacaagaatctatattctacttaccgatacatttgttttagttgatttt
atacgtttaatgcaacgaaaaaaattacttgataccggtctttatgcaattgtttcggtt
gaagaagaagtattttattcagtaaaaaaaggtggttatcttaataaacaatataaaaat
ctacgtaatttagatcatttggatctgagaggtttaatgattataacaccaagtccacca
ttaaatatgaattattcggaatttcaaaaagatgttcttgaatataatcgtcgtgatcca
tttagtataccgtttcataaaaaaattgccatacaggtaccaatttatggtggtctacta
tatgatgctgttacagttattgcacaagcatttcataaagttattgaaaatggacaaaat
atttccaatggtattattgttatggatgcattgaaaaatcttaattataaaagtatactt
ggattcaatgtacatatggatgaaaatggtgatgctgaaggcaattatacattactttgt
ttagatattgttaataaaagtatcgatatgcaaattgttggttcatttcatcagactgaa
aatgatttaccggtattaaaattgaatcgtaaattaaaatggtatggtaatggaccaata
ttatccgaaccaatttgtggttttaacaatgaattctgtgataatgtaacaataattatc
ggtatcatattgtttattattatttttataacaatcgttttctttacttttaaacattat
cattatgaatataaattgacaaaagtattatggaaaatcgatatcaaagatattttattc
atacataccgattttgaatatggattacaaaatattcgtaatacaatcaatctacatagt
ttaaaacaaatggaagttgttttcaatacaaataatattcaaaataaaaatgaacaattt
gaaaattcatccatagatattttcgataatcaactttatggtattgccatttataaagga
tcgattacatttgttaagcgaatatgtaaaaaatctattgatcttacccgaaatattcgt
aaagaattgatacagatgcgtgaaatgcgtcatgaaaatataaatcaatttataggtgcc
attattgatgcaccaaacatagccgttatgtttatttattgtgcacgaggaaatcttgag
gatgtactacgtaataaagacattaatctggataacatgtttgttgcatcattagttgcc
gatctgatcaaaggaatgatatatcttcatgattcggatatcatatcacatggtaatcta
aaaccatccaactgtttgatcgatagtcgatgggtattgcaaatatctgattatggtttg
catgaatttaaatctacacaagatctattcaaatcaaaagaaaatcaagaaaaagatatg
ttatggagagcaccagaattattgaaaaatttaaatgcatcaccacgtggatcacaaaaa
ggcgatgtttattcatttgcattaatactatatgaaataatattacgaaaaaatccatat
gaagagattaatatgtcaaataatgaaattttacatcgtattatcaatccaaaattgtat
ggtgaagtatttcgaccacgattaaagaaactaaaatgttcacaatatataattaaatgt
attgaagaatgttggaaagaagaacctgatgaacgaccagattttcgttttatcaatatc
cgattacgtgaaatgcaagctggattgaaaccaaacatatttgacaatatgattgcaatg
ttggaaaaatattcatataatctagaatcattggttcaagaacgaactatacaattgttg
gaagagaaaaagaaaaccgaaaatctattattacgaatgttacccaaatcggcagctgaa
caattaaaacgtggtgaggcagttgaagcggaatactttgattgtgttaccatttatttc
agtgatattgttggctttactgaactttcagcaatgagtacaccgattcaggtggttaat
ttattgaatgatttgtatacctgtttcgattcaattattggtaattatgatgtttataaa
gtggaaacaattggtgatgcctatatggttgttagtggtctgccgatacgtaatgctgaa
aaacatgccggtcaaatagcatcgatggcattacatcttttacaggaaatattcaatttt
gaaattgctcatcgtccaggtgaatatcttaaacttcgtattggtattcattcaggtcca
tgtgtagccggtgttgttggtcttaaaatgccacgttattgtttattcggtgatacagtg
aatgttgcgtcaagaatggaatccactggtgaagcacacaaaatacatgttagctattca
tgtaaacaaattctagataaattagatggctatattcttgaagaacgtggtctaatttcg
atcaaaggaaaaggacagatgcgtacctattggctattggatcgaaatctatcagatgat
tcattataa

DBGET integrated database retrieval system