KEGG   Dermatophagoides pteronyssinus (European house dust mite): 113790076Help
Entry
113790076         CDS       T05775                                 

Definition
(RefSeq) autophagy-related protein 16-1-like
  KO
K17890  autophagy-related protein 16-1
Organism
dpte  Dermatophagoides pteronyssinus (European house dust mite)
Pathway
dpte04136  Autophagy - other
dpte04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:dpte00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    113790076
   04136 Autophagy - other
    113790076
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:dpte04131]
    113790076
   03029 Mitochondrial biogenesis [BR:dpte03029]
    113790076
Membrane trafficking [BR:dpte04131]
 Autophagy
  Autophagosome formation proteins
   Atg12 conjugation proteins
    113790076
 Others
  Rab GTPases of specific organelles
   Auto phagosome
    113790076
Mitochondrial biogenesis [BR:dpte03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Autophagy-related proteins
    113790076
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ATG16 ANAPC4_WD40 WD40_like MPS2 HALZ PRKG1_interact
Motif
Other DBs
NCBI-GeneID: 113790076
NCBI-ProteinID: XP_027195492
Position
Unknown
AA seq 560 aa AA seqDB search
MAIISTATNPTWRKSIIQQLQEQQRKTNEPFESVIQTCVSLFEKIDSLQREKSNSSSSST
TANCDNQTLSNPIPSSSSTASTTATTTLTSATNSTLNDRIQSLQNDLKECQKCIMEKDST
IIELNTKITSLMKEKNDLKSKQTDLKINLDCMLDKCRAYEEVINDLKGQNTCLIDEHTAL
QILYDSLKNKFDKLNQQYNDLVTKVMETKAKDAEIMNEENEKMIRLQQERLRKQLEDDAN
RIMVTSNVENDSVNLIENPVTVIIPERPRINFEPHNEIYALKFDKKTNYLSSGGGDRKVK
LWNFDDIKINLIQVLTGSNASVTSIDIFEEYLVASSSDYASRVWTLNDFRLRRTLTGHSN
KVMSVKFMSVNNKVVSGSYDKTIKVWDLNRNACMRTLFAGSSCTDIANRDENFFASGHID
KHIRFWDSRIETSSATGIQLQGKITSLNVTNNGHYLVAAIRNVDKLTCLDLRMNSFVQNY
TADSFTIGWDWTRLCLSPNDQYIACGGNDSQIFFWDFSSGKLLKTLSTDKHIGTIIAVEW
HPKGNLFASADRNKNIVLWS
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggccatcatatcgacagcaacaaatccaacatggagaaaatcaataatacaacaacta
caagaacaacaacgtaaaacaaatgaaccatttgaatctgtgatacaaacatgtgttagt
ttgtttgaaaaaattgattcattacaaagagaaaaatcaaattcatcatcatcatcaaca
acagcgaattgtgataatcaaacattgtcaaatccaataccatcatcatcatcaacagca
tcgacaacagcaacaacaacattaacttcggcaacaaattcaacattaaatgatcgtata
caatcattacaaaatgatttaaaagaatgtcaaaaatgtataatggaaaaagattcaaca
ataattgaattgaatacaaaaataactagtttaatgaaagaaaaaaatgatttaaaatca
aaacaaactgatttaaaaataaatttagattgtatgttagataaatgtcgtgcatatgaa
gaagttataaatgatttaaaaggacagaatacatgtttaattgatgaacatactgcatta
caaatattatatgatagtttaaaaaataaatttgataaactaaatcaacaatataatgat
ttggttacgaaagttatggaaacaaaagcaaaagatgctgaaataatgaatgaagagaat
gaaaaaatgatacgtttacaacaggaacgtttacgtaaacaattagaagatgatgcaaat
agaattatggttacatcaaatgttgaaaatgattcagtaaatttgattgaaaatcctgtt
acggtaataatacctgaacgaccgagaataaatttcgaaccacataatgaaatatatgca
ttaaaatttgataaaaaaacaaattatctaagtagtggtggtggtgatcgtaaagtaaaa
ttatggaattttgatgatattaaaatcaatctgatacaagtattaaccggtagtaatgca
tcggttacatctattgatatatttgaagaatatttagttgcatcatcaagtgattatgca
agtcgtgtttggacattaaatgattttcgtttacgtcgtacactaactggtcattcaaat
aaagtaatgtcagtaaaatttatgtctgtaaataataaagttgtatcgggtagttatgat
aaaacaattaaagtatgggatttaaatcgtaatgcttgtatgcgtacattgtttgccggt
tcatcatgtaccgatattgctaatcgtgatgaaaatttttttgccagtggtcatattgat
aaacatatacgattttgggattcacgtattgaaacatcatcagcaaccggaattcaatta
cagggtaaaattacatcattaaatgttacgaataatggtcattatttggttgccgctata
cgtaatgttgataaattaacctgtttagatttgcgtatgaattcatttgtacaaaattat
acagccgattcatttacaattggttgggattggacccggttatgtttaagtccaaatgat
caatatattgcttgtggtggtaatgatagtcaaatatttttttgggatttttcatcagga
aaattattaaaaacattatcaactgataaacatattggtacaattattgcagttgaatgg
catccaaaaggaaatttatttgcaagtgctgatcgtaataaaaatattgtactttggtca
taa

DBGET integrated database retrieval system