KEGG   Dermatophagoides pteronyssinus (European house dust mite): 113791947Help
Entry
113791947         CDS       T05775                                 

Definition
(RefSeq) pseudouridine-5'-phosphatase-like
  KO
K17623  pseudouridine 5'-phosphatase [EC:3.1.3.96]
Organism
dpte  Dermatophagoides pteronyssinus (European house dust mite)
Brite
KEGG Orthology (KO) [BR:dpte00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:dpte01009]
    113791947
Enzymes [BR:dpte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.96  pseudouridine 5'-phosphatase
     113791947
Protein phosphatases and associated proteins [BR:dpte01009]
 HAD phosphatases
  Other HAD phosphatases
   113791947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like Hydrolase_6 HAD RsmJ
Motif
Other DBs
NCBI-GeneID: 113791947
NCBI-ProteinID: XP_027197603
Position
Unknown
AA seq 300 aa AA seqDB search
MPENQTIIQQCNNCDLDNDNNLKNKCCNRSDTNNNDILPMNNNDNKCCRNGMIKNCCSLN
GMKQQQQQQQQFKPVTHVIFDLDGLLINSEVCFANAIRILLKRFGINEYSKELQEKVLGM
EVARGIEEIIKQTNLPLTVEQFMEMEREIYTDEMLKVKLMPGAKRLVEHLKKHNIPMAIA
TGSTNQSFVIKTRAHQDLFGDGKYFHHIVFTRDDEEVKNPKPAPDVYLITASRFPDRPKP
EQCLVLEDSSIGVDGARAAGMQCVMVPDQRFECKQQNATIILKSLEDFQPELFGLPPFDD
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcccgaaaatcagacaatcattcaacaatgtaacaattgtgatttagataatgataat
aatttaaaaaataaatgctgtaatcgttcagatacaaataataatgatattttacccatg
aataataatgataataaatgttgccgaaatggaatgataaaaaattgttgttcattgaat
ggaatgaaacaacaacaacaacaacaacaacaatttaaaccggtaacacatgttattttt
gatttggatggtttattaattaatagtgaagtttgttttgctaatgctatacgtatatta
ttgaaacgttttggtatcaatgaatatagtaaagaattacaagaaaaagttcttggtatg
gaagttgcacgtggtattgaggagataatcaaacaaacaaatttaccattaactgttgaa
caatttatggaaatggaaagagaaatttatacagatgaaatgttaaaagtaaaattaatg
cccggtgctaaacgtttagttgaacatctaaaaaaacataatataccaatggcaattgca
acaggtagtacaaatcaatcgtttgtaataaaaacacgtgcacatcaagatctatttggt
gatggaaaatattttcatcatattgtttttacacgtgatgatgaagaagtaaaaaatcca
aaaccagcaccagatgtttatttgataacggcaagtcgttttcctgaccgaccaaaaccc
gaacaatgtcttgtattggaagattcatcaatcggtgttgatggtgcacgtgcagctggt
atgcaatgtgttatggtacctgatcaacgttttgaatgtaaacaacagaatgcaactata
atattaaaatcattggaagattttcaaccagaattatttggattaccaccatttgatgat
taa

DBGET integrated database retrieval system