KEGG   Dermatophagoides pteronyssinus (European house dust mite): 113792624Help
Entry
113792624         CDS       T05775                                 

Definition
(RefSeq) UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase-like
  KO
K01001  UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase [EC:2.7.8.15]
Organism
dpte  Dermatophagoides pteronyssinus (European house dust mite)
Pathway
dpte00510  N-Glycan biosynthesis
dpte01100  Metabolic pathways
Module
dpte_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:dpte00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    113792624
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dpte01003]
    113792624
Enzymes [BR:dpte01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.15  UDP-N-acetylglucosamine---dolichyl-phosphate N-acetylglucosaminephosphotransferase
     113792624
Glycosyltransferases [BR:dpte01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   113792624
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_4
Motif
Other DBs
NCBI-GeneID: 113792624
NCBI-ProteinID: XP_027198336
Position
Unknown
AA seq 407 aa AA seqDB search
MDPLNYTLYINGFMSILAYFAVKNIIPKMSSMFIEAHLFGNDLCKKDQTKKIPESQGVIG
GCVYLIILFCFIPIQFSQYKSSSAINPHLSFIDHHLFVQFLAGLLSICCMLFLGFADDVL
NLRWRIKLLLPTLASLPLLLVYALTYDNTTIIVPKPLRSLLGFSIDLNLVYYVYLSLLAV
FCTNAINILAGINGLETGQSLLICLSIIVYNCVELVRQTDHYHSHVFSLNMMLPFLAVTS
ALFHHNWYPARIFVGDTFCYFAGMTFAVVGILGHFSKTMLLFFLPQIFNFLYSCPQLFHF
LPCPRHRLPKYNQRTDLMEPSTFIIPNDIGGLAKLMLKTLSLLRLIELREPPKSTNQQCS
NLTLINLMLVLFGPMHESKLTRLLLIVQFCATLIAFFIRYGLSEIFY
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atggatcctttaaattataccttatacattaatggcttcatgtcgatattggcatatttt
gctgtcaaaaatattatacccaaaatgagctcaatgtttatcgaggcgcatttgtttggc
aatgatctgtgtaagaaagatcaaaccaaaaaaattccagaatctcaaggtgtaattggt
ggatgcgtctatctaatcattttattctgttttataccgatacaattcagtcaatataaa
tcatcatcggcaatcaatcctcatctatcatttatcgatcatcatttgtttgttcaattt
ttagccggtttattatcaatatgttgtatgctgtttcttgggtttgccgatgatgttcta
aatcttcgatggcgtattaaattattgctaccaacattggccagtttaccgttgttattg
gtctatgcattaacctatgataatacaacgattatagtgccaaaaccattacgttcatta
ttgggtttcagcatcgatctgaatctggtttactatgtctatctatcattgttggccgta
ttctgtacgaatgccatcaatatattggccggtatcaatggcttggaaactggacaaagt
ctactgatttgtctttcgatcatcgtttacaactgtgtggaacttgttcgtcaaaccgat
cattatcattcgcatgttttttcgctgaatatgatgttgccatttttggccgtaactagc
gctctgtttcaccataattggtatccagccaggatattcgttggcgatacattctgttat
tttgccggaatgacatttgccgtcgtcggtatcctaggacatttcagcaaaacaatgtta
ctatttttcctgccgcaaatattcaattttctttattcatgtccgcaattgtttcatttt
ctgccatgtccacgacatcgattacccaaatacaatcaacgaaccgatcttatggaacca
agtacattcatcattccaaacgatattggtggccttgctaaactaatgctgaaaacatta
tcgctgttaaggttaatcgaattgcgtgaaccacccaaatcaactaatcaacaatgttca
aatctaacgctaatcaatctcatgttggtattattcggacctatgcatgaatcaaaacta
acccgattactattgattgtacaattttgcgccactttgatcgcattctttatacgttat
ggattaagtgaaatattttattaa

DBGET integrated database retrieval system