KEGG   Dermatophagoides pteronyssinus (European house dust mite): 113792811Help
Entry
113792811         CDS       T05775                                 

Definition
(RefSeq) alpha-1,3/1,6-mannosyltransferase ALG2-like
  KO
K03843  alpha-1,3/alpha-1,6-mannosyltransferase [EC:2.4.1.132 2.4.1.257]
Organism
dpte  Dermatophagoides pteronyssinus (European house dust mite)
Pathway
dpte00510  N-Glycan biosynthesis
dpte01100  Metabolic pathways
Module
dpte_M00055  N-glycan precursor biosynthesis
Brite
KEGG Orthology (KO) [BR:dpte00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    113792811
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dpte01003]
    113792811
Enzymes [BR:dpte01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.132  GDP-Man:Man1GlcNAc2-PP-dolichol alpha-1,3-mannosyltransferase
     113792811
    2.4.1.257  GDP-Man:Man2GlcNAc2-PP-dolichol alpha-1,6-mannosyltransferase
     113792811
Glycosyltransferases [BR:dpte01003]
 N-Glycan biosynthesis
  Dol-linked oligosaccharide
   113792811
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4 Glyco_trans_1_2 Glyco_trans_4_4 AKAP7_NLS Glyco_trans_4_5 DUF5592
Motif
Other DBs
NCBI-GeneID: 113792811
NCBI-ProteinID: XP_027198556
Position
Unknown
AA seq 408 aa AA seqDB search
MSSIAFLHPDLGIGGAERLIVDLALALKDCGHSVIIFTSHHNRDHCFEETNNGQIPVITA
GDWIPRSTFGSFMAFWAYIRMIYLTIYLILNYRFDLIICDQVPSGVPILKAFKHKCLFYC
HFPDQLLSKHDSFLKKIYRFPIDFFEEWAIGYSDMILVNSYFTDEVFHRTFKSLSNISTK
VLYPSVNFNKSIPEKIPSTLNTKLKNMDAVFLSINRYEKKKNIELAIEALKALYDKFNYV
EEKDRSLIHLIIAGGYDLQNIENLEYAEELNQLAKRLRIKPHVTFMKNLTNEQKQFLFQR
CTAVIYTPENEHFGIVPLEAMYMSRPVIAANSGGPRETIINNETGFLCQPNSPESFAEAM
HRFIENKTLSNQMGAKGHDHVIEKFNHQKFKNELNKIVTNLILINQHE
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcgattgcgtttcttcatccggaccttggaattggtggggccgaaagattgatt
gttgatctggctttggctctaaaagattgtggccattcagtaatcatattcacttctcat
cataatcgagatcattgttttgaagaaaccaataatggtcagatacctgtgatcactgct
ggtgattggataccacgatctacattcggatcgtttatggctttttgggcatatatacgc
atgatttacttgaccatctatttaattctaaattatcgttttgatttgatcatctgtgat
caggttccaagtggtgttccaatattgaaagctttcaaacataaatgccttttttattgc
cattttcctgatcaacttttatctaaacatgattcttttttaaagaaaatttatcgtttt
cctattgattttttcgaagaatgggccattggttattcggacatgattttggtcaattct
tatttcaccgatgaagtatttcatagaacattcaaatcattatccaacatatcaacaaaa
gttctttatcccagtgttaatttcaacaaatcgattccagaaaaaatacctagtactttg
aatactaaactgaaaaatatggatgcagtttttctttcgatcaatcgttatgaaaaaaag
aaaaacattgaacttgcaattgaagcattgaaagctctttatgataaatttaattacgta
gaagaaaaagatcgatctttaatacatttaattattgccggtggatatgatctccaaaat
atagaaaatcttgaatatgctgaagaattaaatcaattagcaaaaagattacgaattaaa
cctcatgttacattcatgaaaaatctgaccaatgaacaaaagcaatttctttttcaaaga
tgtacagctgttatttatacgcctgaaaacgaacatttcggtattgtaccattagaagca
atgtatatgagtcgtccagtaattgcagctaacagtggtggaccacgtgaaacaatcatt
aataatgagaccggattcttatgtcaacctaattcgcccgaatcatttgccgaagcaatg
catcgatttattgaaaataaaactctttccaatcagatgggtgcaaaaggtcatgatcat
gtgattgaaaaattcaatcatcaaaaatttaaaaatgaactgaacaaaatcgtaactaat
ttaatattaataaatcaacatgaataa

DBGET integrated database retrieval system