KEGG   Dermatophagoides pteronyssinus (European house dust mite): 113793390Help
Entry
113793390         CDS       T05775                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit B, mitochondrial-like
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
dpte  Dermatophagoides pteronyssinus (European house dust mite)
Pathway
dpte00970  Aminoacyl-tRNA biosynthesis
dpte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpte00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    113793390
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dpte03029]
    113793390
Enzymes [BR:dpte01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     113793390
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     113793390
Mitochondrial biogenesis [BR:dpte03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    113793390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GatB_N GatB_Yqey GABP-alpha DUF5457
Motif
Other DBs
NCBI-GeneID: 113793390
NCBI-ProteinID: XP_027199217
Position
Unknown
AA seq 564 aa AA seqDB search
MFLRLFKFSNFNINTSLKNGFHSASQTLFFSCKAEKYLDKYEPVIGLEVHAQILSDSKLF
SSASTNFTSRPNSQATYFDVSLPGTLPVLNRKCVLAAIKTGLALNCRISNKSTFDRKHYF
YGDMPNGYQITQQRNPIARDGYIEFIVYDDFYENDRSFQPYLKQCRLKQIQLEQDSGKSL
VDGEMNANLIDLNRAGVPLLEFVFEPDLSSTLEAISLVRELIAILKSIQACSCRMEEGAL
RVDANVSVRLVGNRELGTRTEIKNLNSFRFIREASEYEIRRQCSLLERGEKIINETLGYD
IRTKNTFVMRDKEIVQDYRFMPEPNLPAIVLTNDAEDMSKELININSIQKEMPRLPEHIR
QSLLDKRFGLSLREIYFLLQDSTQLHLFHQIFESSRRKCGLDCFEFLIGYLKPIFQEKID
PFTLNKIESINYRFSMENISEFVCQEYLGQLCDMIFDEKISETTAYDILKLYLQNEKRSP
HEIVENYNWWLIKDMDQIENVCRQVIQQVPKIAKKYAKNGVRKQKSMLIQKAFVLMNHQV
NEKMLWEIYDKLLRPTSKPFDKKQ
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgttcctaaggttgttcaaattttcaaatttcaatattaatacgagcctgaagaatggc
tttcattcggcttcgcagactttatttttttcatgtaaagctgaaaaatatcttgacaaa
tatgaaccagtaatcggtttagaagttcatgctcaaatcttatccgattcaaaattgttt
tcatctgcatcaacaaatttcacatcgcgtcccaattcacaggccacttatttcgatgta
tcattacctggaacattaccagtattgaaccgaaaatgtgttctcgctgccatcaaaacg
ggtttggctttgaactgtagaatttcaaataaaagtacatttgatcgcaaacattatttt
tatggtgatatgccgaatggatatcaaatcacacagcagagaaatccaattgctcgagac
ggatacattgaatttatcgtatatgatgatttttatgaaaatgatagatcatttcaacca
tatctaaaacaatgtcgtttgaaacaaatccaattggaacaagattctggaaagtctttg
gtcgatggggaaatgaatgccaatttgattgatttgaatcgtgctggtgtaccactattg
gaatttgtattcgaaccagatcttagttccactttagaagcaatatcattagtacgagaa
ttgattgccattcttaaatcaatacaagcatgttcatgtcggatggaagaaggtgccctt
cgcgttgatgctaatgtttctgttcgacttgttggtaaccgtgaattaggaacacgaact
gaaattaaaaatctcaattcctttagatttattcgcgaagcttctgaatatgaaattcga
agacaatgttcattgttagaaagaggtgaaaaaataatcaacgaaacccttggctatgac
atacgaactaaaaatacgtttgttatgcgcgataaagaaattgtacaagattatcgtttt
atgcctgagccgaatttgcctgcaattgttcttactaatgatgccgaagatatgtctaaa
gaattgattaatatcaattccattcaaaaagaaatgcctagattacctgaacatatccgt
caaagtcttttagacaaaagatttggtttatcgctgagggaaatctattttcttcttcag
gattcgactcagttgcacttgtttcatcaaatattcgaatcttcacgacgaaaatgcggt
ttagattgctttgaatttctcatcggttatttgaaaccgatttttcaagaaaaaattgat
ccatttactttgaacaaaatcgaatcgataaattatagattttcaatggaaaatatatcg
gaatttgtttgtcaagaatatttgggccaattatgtgatatgatatttgatgaaaagatt
tcggaaacgactgcttatgatattctaaaattatatctccagaatgaaaaaagatcgcct
catgagattgtcgagaactataattggtggttaataaaggatatggatcaaatagaaaat
gtttgtcgtcaagttatccaacaagtacccaaaattgccaagaaatatgctaagaatggt
gtacgaaaacaaaaatccatgctcatacagaaagcttttgttttgatgaatcatcaagtc
aatgaaaaaatgctatgggaaatctatgataaattattgcggcccacatcgaaaccattc
gataaaaaacaataa

DBGET integrated database retrieval system