KEGG   Dermatophagoides pteronyssinus (European house dust mite): 113794556Help
Entry
113794556         CDS       T05775                                 

Definition
(RefSeq) ATP-dependent RNA helicase DHX8-like
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
dpte  Dermatophagoides pteronyssinus (European house dust mite)
Pathway
dpte03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:dpte00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    113794556
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dpte03041]
    113794556
Enzymes [BR:dpte01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     113794556
Spliceosome [BR:dpte03041]
 Complex C
  Other components
   Step II factors
    113794556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_19 T2SSE AAA_30 AAA_16
Motif
Other DBs
NCBI-GeneID: 113794556
NCBI-ProteinID: XP_027200471
Position
Unknown
AA seq 1253 aa AA seqDB search
MDELDKLQYLSLVSKVCTELENHLGFNDKDMAEFIIDLADENSTFDSFKTALIANQAQFT
DSFIANLLRIIQHMRPKKKSKNVDLDDDDDDKNDDRKKDDKEMKRALYPCLALPDQELSQ
KSDDEEVVEKENLEDIDDTMKLLEQLSEKNKQTSDNDDDKDDKHKQRRKENDRDVSDKKR
SHRRHDDSDSRRRDRDRDRDRDRRHRRSRSRERHHRYKSDDDEYEKHRSRHSESKRRSHH
GDDYDDNDDNRRSSHSKRTKYEDLPEVPAVGMILNGRVSNIMQFGCFVQLEGLRKRWEGL
VHISQLRREGRVNDVNEVVSRGQNVKVKVLSFTGQRTSLSMKEVDQQTGKDLNPINHQHG
SRSKGVGDDNDDDLSEFKNPDRPSNLPPLPGSSVQSKIDDDSVEDSETRRRIIQRISSPE
KWELKQMAAANVLDRSQLPDFDEKLGVLPRIDEDDDEDIEIELVEEEPSFLRGHGRSHLT
DLDPVRIVKNPDGSLAQAAMMQSALSKERRELKQQQQQSEMNKSRPEDSKDWFDPMPQNP
TPETIGAGWSSNSGGIGNTTSGMPNEMPEWKRFITGGAKASYGKRTELSLMEQRQSLPIY
HFKDELCKAVGDNQILIVIGETGSGKTTQITQYLAEAGYVTRGKIGCTQPRRVAAMSVAK
RVADEFGCRLGCEVGYTIRFEDCTSPETVIKYMTDGMLLRECLLDADLRGYSVLMLDEAH
ERTIHTDVLFGLLKKAVKKRPDLKLIVTSATLDAVKFSQYFFEAPIFTIPGRTFPVEILY
TKDPETDYMDASLLTVMQIHLTEPPGDILLFLTGQEEIDTACEVLYERMKCLGPDVPELL
ILPVYSALPSEMQTRIFEPTPPGSRKVVIATNIAETSLTIDGIYYVVDPGFVKQNVYNPK
TGMDSLVVTPISQAQAKQRAGRAGRTGPGKCFRLYTERAYRDEMLTTPVPEIQRTNLSET
VLQLKAMGINDLINFDFMDAPPAEALLMALEQLHSLGALDDEGLLTRLGRRMAEFPLEPR
LCKVLLQSVQLGCSEEALTVVSMLSVQNVFYRPKDKQALADSKKAKFNQPEGDHLTLLAV
YNAWKNNKLSTAWCYENFVQVRTLKRTQDVRKQLLGIMDRHRLDVISCGKNTAKLQKAIC
SGFFRNTSKKDPQEGYRTLVDGQVVYIHPSSALFHQQPEWVIYHEIVLTTKEYMREVTTI
DPRWLVEFAPTFFRFSDPSKLSKHKKQLRLEPLYNKYEEPNSWRISRVRKRRN
NT seq 3762 nt NT seq  +upstreamnt  +downstreamnt
atggacgaattagacaaactacaatatctttctttagtttcgaaagtttgtaccgaattg
gaaaatcatttaggtttcaacgataaagatatggccgaatttataatcgatttggctgat
gaaaattctacatttgattcattcaaaacggcattgatagcaaatcaagctcaatttact
gattcatttattgccaatcttcttcgtattattcaacatatgcgaccgaagaaaaaatca
aaaaatgttgatctcgatgatgatgatgatgacaaaaatgatgatcgaaaaaaagatgat
aaagaaatgaaacgtgctctttatccatgtttagcgttgcctgatcaagaattgagccaa
aaatccgacgacgaagaagtagtagaaaaagaaaatcttgaagatattgatgatacaatg
aaattattggaacaattatcagagaaaaataaacaaactagtgataatgatgatgataag
gatgataaacataaacaacgacgaaaagaaaatgatcgagatgtgagcgataaaaaacgt
agtcatcgtcgacatgatgattctgattcccgaagacgagatcgtgatcgagatagagat
agagatcgtcgccatcgaagaagtcgcagtcgagaacgacatcatcgttacaaatccgat
gatgatgaatatgaaaaacatcgatcaagacattccgaatcaaaaagacgatcccatcat
ggtgatgattatgatgataatgatgataatcgacgatcttcacatagtaaacgaacaaaa
tatgaagatctacctgaagtaccggctgtaggaatgatattgaatggtcgtgtttcgaac
attatgcaatttggttgttttgttcagcttgaaggtttacgtaaacgatgggaaggttta
gtgcatatatcacaattacgtcgtgaaggtcgtgttaatgatgttaatgaagtggtcagc
cgtggacaaaatgtcaaagtaaaagtattatcatttactggtcaacgaacaagtttatca
atgaaagaagttgatcaacaaactggtaaagatttaaatccaatcaatcatcaacatgga
tctcgtagtaaaggtgttggtgatgataatgatgatgatttatcggaatttaaaaatcct
gatcgaccttcaaatctaccaccattaccgggtagcagtgtccaatctaaaatcgatgat
gattctgtagaagattctgaaactcgtcgtcgtattatacaacgaattagttcacccgaa
aaatgggaattaaaacaaatggctgctgcaaatgttttggatcgttcccaattaccagat
tttgatgaaaaattaggtgtactaccaagaatcgatgaagatgatgatgaagatattgaa
attgaattagtggaagaagaaccatcatttcttcgtggacatggtcgatcacatcttaca
gatttagatccggttagaattgttaaaaatcctgatggatcattagcacaggctgcaatg
atgcaatcagcattatcaaaagaacgacgtgaattaaaacaacaacaacaacaatcggaa
atgaataaaagtcgaccagaagattcgaaagattggtttgatccaatgccacaaaatcct
acacctgaaacaattggagctggttggagtagtaatagtggcggtatcggtaatactact
agtggaatgcctaacgaaatgcccgaatggaaacgatttattactggcggtgcaaaagca
tcgtatggtaaacgtactgaattaagtttgatggaacaacgacaaagtttaccaatctat
cattttaaagatgaattatgtaaagctgttggtgataatcaaatattgattgttattggt
gaaactggatcgggaaaaactacccagattacacaatatttagctgaagctggttatgta
acacgtggtaaaattggttgtacacaaccacgtcgtgttgcagcaatgtccgttgcaaaa
cgtgttgctgatgaatttggttgtcgtttaggttgtgaagttggttatacgattcgtttt
gaagattgtacaagtccagaaacagttattaaatatatgaccgacggtatgttacttcgt
gaatgtcttttggatgcagatctgcgtggttattcagtattgatgttggatgaagcacat
gaacgtactatacatacggatgttctatttggtttattgaaaaaagcagtaaaaaaacga
ccagatttaaaattaattgttacatcggcaacattggatgctgtaaaattttcacaatat
ttttttgaagcacctatttttacaatacctggtcgaacatttccagttgaaatattatat
acaaaagatcctgaaactgattatatggatgcatcattattaactgttatgcaaattcat
ttaactgaaccaccgggtgatatactgttatttcttaccggtcaggaagaaattgatact
gcatgtgaagttctttatgaacgtatgaaatgtcttggtcctgatgtaccggaattatta
atattaccagtttattcagcattaccttcggaaatgcaaacccgaatatttgaaccaaca
ccacctggatcaagaaaagttgttattgctacaaatattgctgaaacatcattaacaatt
gatggtatttattatgttgttgatccgggttttgttaaacaaaatgtttataatccaaaa
actggtatggattcattggttgtaacaccgatttcacaagcacaagctaaacaacgtgct
ggtcgtgcaggtcgtactggaccgggtaaatgttttcgtctatatactgaacgtgcatat
cgtgatgaaatgcttacaacacctgtaccagaaatacaacgtacaaatctttcggaaact
gttttacaactaaaagcaatgggtattaatgatttaattaattttgattttatggatgca
ccaccagctgaagcattattaatggcattagaacaattacattcattaggtgcattagat
gatgaaggtctactaacaagattaggtagacgtatggctgaatttccattagaaccacgt
ttatgtaaagtattattacaatcagtacaattaggctgttcggaagaagcattaacagtt
gtatcaatgttatccgtacaaaatgttttctatcgtccaaaagataaacaagcattggct
gattcaaaaaaagcaaaatttaatcaacctgaaggtgatcatctaacattattagccgtt
tataatgcatggaaaaataataaattgtcaactgcttggtgttatgaaaattttgttcaa
gttcgtacattaaaacgaacacaagatgtacgaaaacaattactaggtattatggatcgt
catcgtttagatgttatatcatgtggtaaaaatacggccaaactacagaaagcaatttgt
tcgggttttttccgtaatacatcgaaaaaagatccacaagaaggatatcgtacattggtt
gatggtcaagtggtttatattcatccatcatcagcattatttcatcaacaacctgaatgg
gttatttatcatgaaattgttttaacaacaaaagaatatatgcgtgaagtaacaactatt
gatccacgatggttagttgaatttgcaccaacattttttcgtttttctgatccatctaaa
ttatctaaacataaaaaacaattacgattagaaccattatataataaatatgaagaacca
aattcatggcgtatttcacgtgttcgtaaacgacgaaattaa

DBGET integrated database retrieval system