KEGG   Dermatophagoides pteronyssinus (European house dust mite): 113795103Help
Entry
113795103         CDS       T05775                                 

Definition
(RefSeq) aromatic-L-amino-acid decarboxylase-like
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
dpte  Dermatophagoides pteronyssinus (European house dust mite)
Pathway
dpte00350  Tyrosine metabolism
dpte00360  Phenylalanine metabolism
dpte00380  Tryptophan metabolism
dpte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpte00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    113795103
   00360 Phenylalanine metabolism
    113795103
   00380 Tryptophan metabolism
    113795103
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpte04147]
    113795103
Enzymes [BR:dpte01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     113795103
    4.1.1.105  L-tryptophan decarboxylase
     113795103
Exosome [BR:dpte04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   113795103
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase SepSecS Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 113795103
NCBI-ProteinID: XP_027201091
Position
Unknown
AA seq 500 aa AA seqDB search
MNSDEFREASKQLTDYIADYIEGLRQRSVVPDVEPGYLNDLVPELPPEQGEPWCNLFNDI
EPVIMKGMTHWHSPRFHAYFPTANSYPAICGDMLSTALACIGFTWNAAPSCTELEMRMMD
WLAWMIGLPEYFQFKYGPGGGVIQTTASESTLIAILGARTQILKQYGLDNRIADDQDDDE
DQEDGQGGQYDGHSKHYELLGRMVAYASNQSHSSVEKAAMLSATRIRLIPVDREKNYSMN
VDRLRKRIIADKQRGLIPMIVIVTLGTTNTCSFDNLFRIGEICSEFRIWLHVDAAYAGSA
FVCPEFRHYMHGIEHATSFTMNPHKWLLVNFDCNAFWVKDKSLIEDAFIVNPVYLKHENQ
NRILDYRHWQIPLGRRFRSLKMWFVFRSYGLNGLQKHIRKQIELAKLFGQLLKTDDRFEL
FDEIRMGLVCFRLKGSNELNEKLLQSINHGKEIFLTPAKVNEQFIIRFAICSRTTEEMDV
QFSWNLIQKHADQIILQRPK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaattcagatgaatttcgtgaagcatccaaacaattaacagattatattgctgattat
attgaaggtttacgacaaagatcagttgtaccggatgttgaaccaggttatctgaatgat
ttagtaccagaattaccacctgaacaaggtgaaccatggtgtaatctgtttaatgatatt
gaacctgttattatgaaaggaatgacacattggcattctccacgttttcatgcatatttt
ccaacagccaattcatatccagcaatttgtggtgatatgttatcaactgcattggcctgt
attggttttacttggaatgcagcaccatcatgtaccgaactggaaatgcgtatgatggat
tggcttgcatggatgattggcctaccagaatattttcaatttaaatatggtcctggtggt
ggtgttatacaaacaacggcaagtgaatcaacattaattgcaatacttggtgcacgtaca
caaattcttaaacaatatggtttggataatcgtattgctgatgatcaagatgatgatgaa
gatcaagaagatggtcaaggtggtcaatatgatggccattcaaaacattatgaattactt
ggtcgtatggttgcttatgcatccaatcaatcacattcaagtgttgaaaaagcagcaatg
ttaagtgcaacaagaatccgattgattccggttgatagggaaaaaaattattcaatgaat
gttgatcgattacgaaaacgtattatagctgataaacaacgtggtctaattccaatgatt
gtcatagttacattaggtacaacaaatacatgttcatttgataatcttttccgtattggt
gaaatatgttcagaatttcgaatatggttacatgttgatgctgcttatgctggttcagca
tttgtttgtccagaatttcgtcattatatgcatggtattgagcatgcaacatcatttaca
atgaatccacataaatggcttttagttaattttgattgtaatgcattttgggtaaaagat
aaaagcctaattgaagatgcattcattgtgaatccagtttatttaaaacatgaaaaccag
aatcgtattcttgattatcggcattggcaaataccattaggacgacgatttcgttcatta
aaaatgtggttcgtatttcgtagctatggtctgaatggactgcaaaaacacattcgaaag
caaatagaattggcaaaattattcggacaattgttaaaaactgatgatcgatttgaattg
tttgatgaaatacgaatgggtttagtttgttttcgattaaagggatcaaatgaattgaat
gaaaaacttttacaatccatcaatcatggaaaggaaatatttttaacaccagcaaaagta
aatgaacaatttattatacgatttgccatttgttcacgtacaaccgaagaaatggatgtt
caattttcatggaatttaattcaaaaacatgctgatcaaattattcttcaacgaccgaaa
taa

DBGET integrated database retrieval system