KEGG   Dermatophagoides pteronyssinus (European house dust mite): 113795355Help
Entry
113795355         CDS       T05775                                 

Definition
(RefSeq) ATP-dependent RNA helicase HAS1-like
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
dpte  Dermatophagoides pteronyssinus (European house dust mite)
Brite
KEGG Orthology (KO) [BR:dpte00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:dpte03041]
    113795355
   03009 Ribosome biogenesis [BR:dpte03009]
    113795355
Enzymes [BR:dpte01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     113795355
Spliceosome [BR:dpte03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    113795355
Ribosome biogenesis [BR:dpte03009]
 Eukaryotic type
  90S particles
   Helicases
    113795355
  Pre-60S particles
    113795355
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C Y_phosphatase DUF4217 ResIII DSPc ERCC3_RAD25_C
Motif
Other DBs
NCBI-GeneID: 113795355
NCBI-ProteinID: XP_027201351
Position
Unknown
AA seq 610 aa AA seqDB search
MSNSILTSQSFSELEGVSEKLKSNLAANAFAKMTHIQATVIPALLQGRDVIGAARTGSGK
TIAYLVPIVSLLYNLRVKPSFGTVALVIAPTRELALQIFDVAKLLTQNFTFRLGCIIGGN
KRSVELDNLKKGVVLLIATPGRLLDHLEHSKGFEIQQLKFLVIDEADRVFSCGFEKDLKQ
ILDKLPKDRQTALFSATITESISKLALSTMRNPLFIDVKPEQGSLALPQYYTVCSGFAKL
ATLFKILKEKSKDFCENEAKSSMKIMIFISTCQSVQFHEMLFRLFGKLLPIFSLHGDKKQ
AKRTEIFHAFSKARNGILFCTNVAARGLDIPAVNLIVQYDPPEQIANYVHRIGRTARGVN
ATGTALLFLAPNETLFVHELKQLSYELTHLKSKQSSLDKIAQQIVKLIAATPELTQQAAL
AFRKYILAYQSHDQKEIFDVSKLNISEIAHSFGLSEPIFSVARAHPAKNRYANIAPFDTN
RVVINKGDGYINASWMDPLANGHRQWDDFNVPSMKLMQEFIDELMAEHSNLFYSNDEGNI
FIHCSGGIGRTGTLITALCAFKLKEHANEKLLVDVLTRLKNQRVGSVGYRVQFEFLHAYL
KQLLGANEAA
NT seq 1833 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattcgattcttacctcacagtcgttcagtgagttggaaggcgtgagcgagaag
ctgaagagcaacctcgcggcgaatgcttttgccaagatgacgcacatccaggcgacagtt
atcccagcgctcctgcagggccgcgacgtcatcggcgcggcgcgcactggcagtggcaaa
accatcgcgtacctggtcccaatcgtgagtctcctctacaacctgcgcgtgaagcccagt
ttcggaaccgtcgcactggtcatcgcgccgactagagagttggcgctgcagatatttgac
gtcgcgaagctgctgacgcagaacttcacatttcgacttggctgcatcatcggcgggaac
aagcgcagcgtcgaactcgacaatctcaaaaaaggcgtcgtgctgctcattgcgacgcca
ggtcggctgttggaccatttggagcactcgaaagggttcgaaatccagcagctgaagttt
ttggtaatcgatgaggcggaccgtgtattcagctgcgggttcgaaaaagacctgaagcaa
attctggacaagctgcccaaggatcgccagactgcgctgttctccgcgacaatcaccgag
tcaatcagcaaactggcgctcagcacgatgcgcaacccgctcttcatcgacgtcaagccc
gaacaaggaagtttggccttgccgcagtactacacggtgtgctcgggattcgcgaagctc
gcaacactattcaaaattctgaaggaaaagagcaaagacttttgcgaaaacgaggcgaag
tcctccatgaagatcatgatcttcatttccacgtgccagtctgtgcaattccacgagatg
ctcttccggctcttcggcaagctgctaccgatcttcagtctgcacggggacaaaaaacag
gcgaaacgcacggaaattttccacgcgttcagcaaagcgcgcaacggcatcttgttttgc
acgaacgtagcagcgcgcggactagacattcccgcggtaaacctgattgtgcagtacgac
cctccggagcaaatcgcaaactacgtgcaccgcatcgggcgcaccgcgcgcggagtgaac
gcgaccggtactgctttgcttttcttagcgccgaacgaaacgcttttcgtgcacgaactg
aaacaactgagctacgaactcacgcacttgaagtccaagcaaagctcgctggacaaaatt
gcacagcaaatcgtgaaactgatcgcggccacgccggagcttacgcaacaggccgcgctg
gcattccgcaagtacatcttggcgtatcagagccacgatcagaaagagatattcgacgtc
tcgaaattaaatatatccgaaattgcccacagcttcggtctctcagaaccaattttttcg
gtggcccgtgcccacccagcgaaaaatcgatacgccaacattgcccctttcgacacaaac
agagtggttatcaacaaaggcgatggctacatcaacgcttcttggatggatccgctggcc
aacgggcatcgccaatgggacgatttcaatgtgcctagcatgaagctgatgcaagaattc
atcgacgaactgatggctgaacactccaatttgttctactctaatgacgaaggcaacata
tttattcactgttcgggcggcattggccgaacgggaactttaataacagcgctttgcgcg
ttcaagctgaaagagcacgcgaacgagaagctattggtcgacgtgttgactagactcaaa
aaccagcgcgtaggctccgtgggctacagagtgcaattcgagtttcttcacgcctacctt
aaacagttgctcggcgcaaacgaagcagcatag

DBGET integrated database retrieval system