KEGG   Dermatophagoides pteronyssinus (European house dust mite): 113796723Help
Entry
113796723         CDS       T05775                                 

Definition
(RefSeq) external NADH-ubiquinone oxidoreductase 1, mitochondrial-like
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
dpte  Dermatophagoides pteronyssinus (European house dust mite)
Brite
KEGG Orthology (KO) [BR:dpte00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    113796723
Enzymes [BR:dpte01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     113796723
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 113796723
NCBI-ProteinID: XP_027202825
Position
Unknown
AA seq 546 aa AA seqDB search
MELKTDLKIDESTGLIKDNCDLEDGEISTYKTGSTTLKYNSENFDFYTSMVVLKTGQATS
EDYGTLINPSQNTSENKGERGFKRIISQLRSLRSNNNNQAEPVEENLDDNKLERKQENVF
ALLEMNSDKSDNEESVSQAFTSPREESNRSNMNDFTDIPYLKLAFSKLVDPNKRYSKLWT
NILNKLKKNSNELDSKKENVTVLGSGWASTTFIKNLDPKLYHVTLISPRPWFTMTPLLTA
AISGRIGLRTVISPVSRYLFKYPKRGFELIKGEAIDYLGNNTIKIKTNCNEEKIHKYDKL
VIGVGSVTNTFNIPGVEKKVSFLKTIDDVREIREKLFNNFAIAKNNNLSPKEKEKLLSIA
IVGGGFAGVETAFELQNLIETDLKFMYPDEAKFAKISIVEMLPNMLPICEKSVSEFANNT
LDQQKIKRYNNCRVTLVDADAINVVDKNSTSFKIPASQVIWVSGIMQTSFVKKLIDKIEQ
QKDNRFLLVNPDLSVIGTKDMYAFGDCSRLTVKPLSSIIYKECVRNVSLQKQLCSTTQKL
FEGRFN
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggaattgaaaacagatttaaaaattgatgaaagtactggcttaattaaagacaattgt
gatctggaagatggagaaatttcaacttataaaactggaagcacaacactcaagtacaac
agcgaaaactttgatttctacacgtcaatggtagtgttgaaaacaggtcaagctacatct
gaggattatggtactttaattaatccctcacaaaatacatcagaaaacaaaggtgaaaga
ggtttcaaaaggataatttctcaactaagaagtttgagatccaataataataaccaagcc
gaacctgttgaagaaaatttagacgataataaacttgagcgcaaacaagaaaacgtattt
gctttattagaaatgaattcagacaaaagtgataacgaagagtctgtgtctcaggcattt
acatcgcctagagaggagagtaaccgctcaaatatgaatgatttcactgatattccatat
ttaaagctcgctttttctaagctagtagatccgaataaaaggtattcgaaattatggaca
aatattctgaacaaattaaaaaaaaattcaaatgagctcgacagtaaaaaagaaaatgta
actgttttaggatccggatgggcgagtactacttttattaaaaaccttgatcctaaatta
tatcatgtgacactaatatctccccgtccttggtttactatgacaccactgttaacagca
gcgatcagtggacgaataggactccgtactgtgatcagtccagttagccgttatcttttt
aaatatcccaagcgtggatttgaattgatcaagggtgaagcaattgattacttaggaaac
aatacaataaaaataaagacgaactgcaacgaagaaaaaattcataaatacgataaacta
gtcattggtgttggttctgttacgaacacttttaacatacctggagtggaaaaaaaagtt
agttttctaaaaactattgacgacgttagagaaatcagagaaaaactgtttaataacttt
gccatagccaaaaacaacaaccttagcccaaaagaaaaagaaaagcttctcagtatcgct
attgtaggtggtggatttgctggtgtagaaacagcgtttgaactacaaaatctaatagaa
acagacctgaaatttatgtatccagatgaagctaagtttgcgaaaatatctattgtggaa
atgttgcctaacatgttaccgatttgtgaaaaatcagtaagtgaatttgcaaacaacaca
ctcgatcaacaaaaaataaagcgttacaacaactgccgagtgacattggttgacgccgat
gcgatcaatgttgtagacaaaaactctacgagtttcaagattccggcttcacaagtcatt
tgggttagtggaataatgcaaacatcttttgtaaaaaaacttattgataaaattgaacaa
caaaaggataatcgattcttactagtaaatccagacttgtcagtcattggaactaaagat
atgtacgcttttggagattgttctcgtctaaccgtcaagcctttaagttcaataatttat
aaagaatgtgtcagaaatgttagtttacaaaaacaattatgttcaactacacaaaaacta
tttgaaggacgttttaactga

DBGET integrated database retrieval system