KEGG   Dermatophagoides pteronyssinus (European house dust mite): 113799142Help
Entry
113799142         CDS       T05775                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dpte  Dermatophagoides pteronyssinus (European house dust mite)
Pathway
dpte00010  Glycolysis / Gluconeogenesis
dpte00562  Inositol phosphate metabolism
dpte01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpte00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    113799142
   00562 Inositol phosphate metabolism
    113799142
Enzymes [BR:dpte01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     113799142
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     113799142
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 113799142
NCBI-ProteinID: XP_027205533
Position
Unknown
AA seq 505 aa AA seqDB search
MTIIMWNFSRIFLIIIISIFIDERFVQTTTNESNETTCFDFSNVLSSSTNDTLECNKYRL
FSTKTTYLTAREEIRKIFPTKWPNEELRKCQPIYLFFLNRHSIRYPSAREIGKFNQLLHS
IRRELLESDKLNYRMYIYLITWRFRMLPNDDNHVSYTGKLQTARTAEIFYKLFPTLLDIG
KIPQFDVGISTKIRTEETADAFIDSLINIQLNHQNSQSKNEIKQKKFPKISKDVLMSHKK
CKRLIEDSLSESSESSSSKIPKSKKFSKLLESKPIKMMSINFSQRNGLKYTMKIESLIML
YKACSYETAIYTFSPWCHLFSESELKIIEYLLDIDEYFDAYQIEPYRKMACSVIGDLQSK
LVSIIQQPEAQLTNTTLYFSHENLLSKVFSYFGLFNKFPDVNLDLPSSDDDNDNTRFCIA
DDREWRSSLIVPFGTNFVAVLYKCNSQQQDQHQQQPAFKVLTLVNEIPVIVRGCNSSLCN
IDLFFNEFYNDQNDCDLPKICKLSS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgacgataataatgtggaatttttcccgaatatttttaatcattattatttcgattttt
attgatgaaagatttgttcaaaccaccaccaacgaatcaaatgaaacgacatgttttgat
ttttcaaatgttttatcgtcatcgacaaacgatacacttgaatgtaataaatatcgatta
ttttccacaaaaacaacatatctaactgcaagagaagaaattcgtaaaatttttccaacc
aaatggccaaatgaagaacttcgtaaatgtcaaccaatttatttatttttcctgaatcgt
cattcaatacgttatccatcagcacgtgaaattggtaaatttaatcaactactacattca
attcgcagagaattactggaatcggataaattaaattatcgtatgtatatctatttaata
acatggcgttttcgtatgttaccaaatgatgataatcatgttagttatacgggtaaatta
caaacagcacgaacagctgaaattttttataaattatttccaacattgcttgatattggg
aaaattcctcaatttgatgtcggaatatcaacgaaaattcgtacggaagaaacagctgat
gcttttattgattcattaatcaatattcaattaaatcatcaaaattctcaatcaaaaaat
gaaatcaaacagaaaaaattcccgaaaatctccaaagatgttttaatgtcacataaaaaa
tgtaaacgtcttatcgaggattcattatcggaatcatctgaatcttcatcgtcaaaaata
ccaaaatcaaaaaaatttagcaaacttctcgaaagtaaaccaataaaaatgatgtcaata
aattttagccaaagaaatggattgaaatatactatgaaaattgaatcgttgataatgctg
tataaagcttgttcatatgaaacagctatttatacattttcaccatggtgtcatttattt
tccgaatccgaattgaaaattattgaatatttattagatattgatgaatattttgatgca
tatcaaattgaaccatatcgtaaaatggcttgttcggttattggtgatttgcaatcgaaa
ttagtttcaatcattcagcaacctgaagcccaattgacgaatacaacattatatttttca
catgaaaatttattatcaaaagttttcagttattttggactgtttaataaatttcccgat
gtgaatcttgatctaccatcatcagatgatgataatgacaatactcgtttctgcatagct
gatgatcgtgaatggcgttccagtttgattgtaccgtttggaacaaattttgttgctgta
ctttataaatgtaattctcaacaacaagaccaacatcaacaacaaccggcattcaaagtg
ttaacattagtcaacgaaatccctgttatagtacgtggttgtaatagttcattatgtaat
attgatttattttttaatgaattttataatgatcaaaatgattgtgatttaccgaaaatt
tgtaaattatcatcgtaa

DBGET integrated database retrieval system