KEGG   Deinococcus puniceus: SU48_03605Help
Entry
SU48_03605        CDS       T04339                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
dpu  Deinococcus puniceus
Pathway
dpu00860  Porphyrin and chlorophyll metabolism
dpu00970  Aminoacyl-tRNA biosynthesis
dpu01100  Metabolic pathways
dpu01110  Biosynthesis of secondary metabolites
dpu01120  Microbial metabolism in diverse environments
Module
dpu_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:dpu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SU48_03605
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    SU48_03605
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:dpu01007]
    SU48_03605
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:dpu03016]
    SU48_03605
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:dpu02048]
    SU48_03605
Enzymes [BR:dpu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     SU48_03605
Amino acid related enzymes [BR:dpu01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   SU48_03605
Transfer RNA biogenesis [BR:dpu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    SU48_03605
 Prokaryotic Type
   Other AARSs
    SU48_03605
Prokaryotic defense system [BR:dpu02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    SU48_03605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ANE43010
UniProt: A0A172T7Q3
Position
complement(785776..787233)
Genome map
AA seq 485 aa AA seqDB search
MSDPLSPAPTRPVVTRIAPSPTGDPHVGTAYIGLFNYTLAQQAGGKFILRIEDTDRNRLV
PGSEKRIFTMMQWLGLTPDESPLQGGPNGPYRQSERFDLYSDYARQLVASGAAYYAFETS
EELTALRDAAQAEGHIIAVPSRELDPQEAQQRLDAGAEAVIRLKVPHDGETVVSDVLRKP
IAFQNREIDDKVLLKADGYPTYHLANVVDDRLMGVTHVVRAEEWITSTPIHVLLYRAFGW
PEPVFAHMPLLRNADKSKISKRKNPTSVEWYQQQGYLPGAMLNFLATMGWTHPDGLEVFD
LAEFQRVFRLEDVTLGGPVFDLAKLNWLNGKYLREVLSEDEVARRLYAYLQDQKHELPLD
DYFRAVVTMLIPRMEVFSEFLDKTGYFWTEDYPVNEKAQKAIDDARPLLPELASRLKNLP
TFDAASIKAAFGTFAEEQGLKLGKVMPPVRAAVAGTMESPDLLSVLETLGRERVVARIER
AARPA
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacccgctttcccctgcacccacacgccccgtcgtgacccgaatcgcgcccagc
cccacgggtgacccgcacgtgggcacggcttatatcgggctgttcaattacacgttggcc
cagcaagcaggcgggaagttcattctgcgaatagaagatacagaccgcaaccgcctcgta
ccgggcagcgaaaaacggatttttaccatgatgcagtggctgggcctcacgcccgatgaa
agccccttgcagggcggccccaacgggccttaccgccaatccgagcggtttgacctctac
agcgactatgcgcggcaactcgtggcgtcgggcgcggcctactacgccttcgaaacctcg
gaagaattgacggccctccgcgacgcagcgcaagctgaaggccacatcatcgccgtgccc
tcccgcgagcttgacccgcaagaagcgcagcagcgcctagacgccggagccgaggctgtg
atccgcctgaaagtgccgcacgacggcgaaacggtggtcagcgacgtgctccgcaagccg
attgcctttcagaaccgcgaaattgacgacaaggtgctgctgaaggccgacggctacccg
acctatcacctcgccaacgtggtggatgaccgcctgatgggcgtgacccatgtggtgcgg
gccgaagaatggatcacgtccacgcccattcacgtgctgctgtaccgcgccttcggctgg
ccggaacccgtgttcgcgcatatgccgctgctgaggaacgccgacaaatccaagatcagc
aagcgcaaaaatccgacgagcgtggagtggtaccaacagcaaggctacttgccgggggcc
atgctgaatttcctcgccacgatgggctggacgcacccggacggcctagaagtgttcgat
ctggccgagtttcagcgcgtgttccggctggaagacgtgacgctgggcggcccggtcttt
gatctggcgaagctgaactggctgaatggcaaatacctgcgcgaagtgctgagtgaggac
gaagtggcccgccgcctctacgcctatctgcaagaccagaaacacgagttgcccctcgac
gattacttccgcgctgtggtcacgatgctgattccgcgcatggaagtcttctctgagttt
ctggacaagaccgggtacttctggacggaagactatccggtcaacgagaaggcgcagaag
gccatagacgacgcccgcccgctgctgcccgaactggcctcgcgcctgaagaacttgcct
accttcgacgccgcgagcatcaaggccgcgttcggcacctttgccgaagaacaaggcctg
aaattgggcaaagtgatgccgcccgtgcgtgcagcggtggctggaacgatggaaagcccg
gacttgctgtcggtgctggaaacgctgggccgggagcgcgtggtggcgcgaatagaacgt
gcggcgcggcctgcatga

DBGET integrated database retrieval system