KEGG   Deinococcus puniceus: SU48_08245Help
Entry
SU48_08245        CDS       T04339                                 

Definition
(GenBank) hypothetical protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
dpu  Deinococcus puniceus
Pathway
dpu00564  Glycerophospholipid metabolism
dpu01100  Metabolic pathways
dpu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:dpu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    SU48_08245
Enzymes [BR:dpu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     SU48_08245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: ANE43764
UniProt: A0A172T9Y4
Position
complement(1806607..1807293)
Genome map
AA seq 228 aa AA seqDB search
MTLLRRLLPVAAAGAALYYLRGVYRFRDPVRLPPADADTVLAPADGLVCLVKRVTGGQLY
ADSGSHPIPVGDLTGLPDAAPDGWLVGVYMGPLDVHFTYHPVGGAVVRAHHTGSRQNTPL
LSAGAAASLLAGRPADVLGTRGTLENERHALTTHTIHGEVTTTLVAPGSGLNATTYTREA
DTVRAGNKSAFLDEGGLIFLLLPAAFTPQISVGERVLGAETVVARAEA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgactttgttgcgccgccttctgcccgttgccgctgccggagccgccctgtattacctg
cgcggcgtataccgtttccgcgatccagtgcgcctgccgcccgccgatgccgacacggtt
ctggctcctgccgatggcctggtgtgcctggtcaagcgcgtgacaggcgggcaactctac
gccgattccgggtcacatcccatcccagtgggcgatctgacgggcttgccggacgccgct
cctgatggctggctggtgggcgtgtatatggggccgctggatgtgcattttacctatcac
ccggtgggtggggccgtggtgcgtgcccaccacacgggcagccgccagaacacgccgctg
ctgtcggctggggcggcggcctcgctgctggccgggcgtcccgccgacgtgttgggcaca
cgcggcacgctggaaaacgagcggcacgcgctgaccacccataccattcacggcgaagta
acgacaacgctcgttgcccccggcagcggcctgaatgccaccacctacacccgcgaggcc
gacacggtgcgggcaggcaacaagagtgcctttttggatgaaggcggcctgatcttcctg
ttgctgcccgccgccttcacgcctcaaatcagcgtgggggagcgcgtgctgggcgcagaa
acggtggtggcgcgggccgaagcatga

DBGET integrated database retrieval system