KEGG   Deinococcus puniceus: SU48_08715Help
Entry
SU48_08715        CDS       T04339                                 

Definition
(GenBank) 3-isopropylmalate dehydratase
  KO
K16792  methanogen homoaconitase large subunit [EC:4.2.1.114]
Organism
dpu  Deinococcus puniceus
Pathway
dpu00300  Lysine biosynthesis
dpu00680  Methane metabolism
dpu01100  Metabolic pathways
dpu01110  Biosynthesis of secondary metabolites
dpu01120  Microbial metabolism in diverse environments
dpu01210  2-Oxocarboxylic acid metabolism
dpu01230  Biosynthesis of amino acids
Module
dpu_M00433  Lysine biosynthesis, 2-oxoglutarate => 2-oxoadipate
Brite
KEGG Orthology (KO) [BR:dpu00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    SU48_08715
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    SU48_08715
Enzymes [BR:dpu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.114  methanogen homoaconitase
     SU48_08715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase DUF521
Motif
Other DBs
NCBI-ProteinID: ANE43844
UniProt: A0A172TA71
Position
complement(1909202..1910467)
Genome map
AA seq 421 aa AA seqDB search
MAERILSVRGGKPVYAGDLAVVEVDQVMVVDSIAQSFIERMQRDLEAVPKYPERVSIVID
HVAPASTVSVAQAQKEAREYAAATGVRLFDVGRGICHQVLMEEGLARPGWIVLGSDSHST
TYGAVAAFGTGMGATDIALAAASGKTWLRVPESVKVTFTGNLQPGVSAKDAALEMIRVLG
ADGATYQSVEMHAGDRFSRGERMTLANLCVEAGAKAGLVVPGGEILTDYGYDIPEWVYPQ
AGATYVREVVLDLDALRPRMSAPNEVDNVHDVAALSAELRGMHVDQVFIGTCTNGRIEDL
REAAAVLKGRKVAPGTRLLIIPASSQVMEQAMEDGTLLTLQRAGAALGTPGCGPCMGRHQ
GVLAPGEVCVSTSNRNFIGRMGDKDAKVYLASPAVAAATAVMGRIALPEDVLAVVGAVGG
Y
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggccgaacgcatcctgtcggtacgcggcggcaagcccgtctacgccggagatttggcg
gttgtcgaagtcgatcaggtgatggtggtggactctatcgctcagagctttatcgagcgg
atgcagcgtgacctagaggccgtgcccaagtacccggagcgcgtgtctatcgtgattgac
catgtggccccggcttctaccgtcagtgtggcgcaggcccagaaggaagcccgcgaatac
gccgccgcaacgggtgtgcggctcttcgacgtggggcgcggcatctgccaccaagttctg
atggaagaaggcttagctcgccccggctggatcgtgctgggttccgacagccactccacg
acgtatggcgcggtggcggcctttggcacaggcatgggcgcaaccgatatcgccctggcc
gccgcgagtggcaaaacgtggctgcgtgtgcccgaaagcgtcaaggtcacgtttacgggc
aatcttcaacccggcgtgagtgccaaagacgccgcactggagatgattcgtgtgctgggc
gcagatggagccacctatcagagtgtggagatgcacgccggagaccgcttttcacgtggc
gaacgcatgacgctggcgaacctgtgcgttgaggcgggcgcaaaagcaggattggtggtg
ccgggaggcgaaatcctgaccgattacggctacgacatccccgaatgggtgtatccgcaa
gcgggggccacctacgtgcgcgaagtggtgctggacttggacgccctgcgcccccgcatg
agtgcacccaatgaagtggacaacgtgcatgacgtggccgccctcagcgccgaactgcgc
ggcatgcacgtcgatcaggtgtttatcggcacctgcaccaatggccgcatagaagacttg
cgcgaagccgccgccgtcctgaagggccgcaaggttgcccccggcacgcgcctgctgatt
attccggccagcagtcaggtgatggaacaggcgatggaagacggcaccttgctgaccctg
caacgggcgggcgcggcgctaggcacccccggctgtggcccgtgcatgggccgtcatcag
ggcgtgctggcccccggcgaggtctgcgtatccaccagcaaccgtaatttcatcgggcgc
atgggcgacaaggatgccaaggtgtatttagcgagtccggcagtggcagcggcaacggcg
gtgatggggaggattgctttgccggaggatgtgctggcagtggtgggcgctgtcggcgga
tactga

DBGET integrated database retrieval system