KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_114050Help
Entry
DAPPUDRAFT_114050 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K05925  mRNA m6A methyltransferase [EC:2.1.1.348]
Organism
dpx  Daphnia pulex (common water flea)
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:dpx03019]
    DAPPUDRAFT_114050
Enzymes [BR:dpx01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.348  mRNA m6A methyltransferase
     DAPPUDRAFT_114050
Messenger RNA biogenesis [BR:dpx03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    N6-methyltransferase complex
     DAPPUDRAFT_114050
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: EFX69026
JGI: Dappu1_114050
UniProt: E9HGV6
Position
Unknown
AA seq 145 aa AA seqDB search
MANYVENSSVQAETTVTEEENSLNMDKVDLLKQRRELSRKRKQCLVQTLGMQSVEKLKEA
LGSGKDSSKAEPGMELLRPSEKYIKKNANADGNQQDEETKLLYTDSSTFLKGTQSSNPHN
DYCQHFVDTGQRPQNFIRDVGLADR
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggcaaattatgtggagaattccagtgtacaagcagagacaactgtcacagaagaagaa
aactctcttaatatggataaagtggaccttctaaaacagagaagagaattgtccagaaaa
cggaaacaatgtctcgtacagaccttgggaatgcagtcagtggagaaattgaaagaggca
ttgggaagtggcaaagatagttccaaagcagaaccaggaatggaattacttagaccttca
gagaaatacataaaaaagaatgctaatgctgatggaaatcaacaagacgaagagacaaaa
ctactttacactgattcgtcaacctttctaaaaggaacacagtcttccaaccctcacaat
gactactgccaacattttgttgatactggacagagaccccaaaactttataagagatgtt
ggcttggctgataggtaa

DBGET integrated database retrieval system