KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_114529Help
Entry
DAPPUDRAFT_114529 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx00480  Glutathione metabolism
dpx00590  Arachidonic acid metabolism
dpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    DAPPUDRAFT_114529
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DAPPUDRAFT_114529
Enzymes [BR:dpx01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     DAPPUDRAFT_114529
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx DUF3152
Motif
Other DBs
NCBI-ProteinID: EFX68505
JGI: Dappu1_114529
UniProt: E9HIF7
Position
Unknown
AA seq 170 aa AA seqDB search
MAVWGIMLTAATLLEPMIMNEIRYVRPGNDFQTNVTFFRKIEVNGANDHPLYFYLKKSCP
TTRDFFEPIARLIYSPLRNNDVRCNFEKFLIDRKGKPVKRYDASTRISDMRVDIESLLFP
SVEFVYGSEAVAVRRRKRDWHELRNDTPDLNRPKYGGDLEKKFEIRFDLN
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atggccgtttggggcattatgctcacggctgccacccttttggagcccatgattatgaac
gagattcgttacgtccggccgggaaacgatttccagacgaacgtaacatttttccgcaag
attgaagtcaacggcgctaacgaccatcccttatatttttatctgaaaaaaagttgcccg
acgactcgtgatttcttcgaaccaatcgccagactcatttacagtccattgcgcaacaac
gatgtccgctgtaattttgaaaagtttctcatcgatcgcaagggaaaacctgtgaaacgt
tacgatgccagtactcggatctcagatatgcgcgttgacattgaatcccttcttttcccc
tctgtagaatttgtttatggatctgaagcagttgctgtgaggaggagaaaacgagattgg
cacgagttacgtaatgacactccagatctcaaccgcccgaaatatggcggcgatttggag
aagaagtttgaaattcggttcgacttgaattaa

DBGET integrated database retrieval system