KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_209533Help
Entry
DAPPUDRAFT_209533 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K14286  ethanolamine-phosphate phospho-lyase [EC:4.2.3.2]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx00564  Glycerophospholipid metabolism
dpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    DAPPUDRAFT_209533
Enzymes [BR:dpx01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.2  ethanolamine-phosphate phospho-lyase
     DAPPUDRAFT_209533
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: EFX84674
JGI: Dappu1_209533
UniProt: E9G7B5
Position
Unknown
AA seq 472 aa AA seqDB search
MQGLHQFSTPSDNWCQVHFANSEIKVARASKQYIYDDLGTEFLDCVSSSAHVGHCHPHVV
AASQTQMQKLWTTQGFLNDTYSLYMKKLMDVLPESLSVVYLVNSGSEANDLALRLGRLYT
KRDDVAVFESSYHGNISSLVDVSSKSFKRLPQGKKEFVHVIPLPKCQNIEDQTVENEQAN
QEKYCEDAQRVIENASKNGRPIGILLSEMVISAAGLVIPPLGYFKNLYQMIRNQGGICIA
DEVQTSLGRIGGDFWAFQLYGVVPDILTFGKSIGNGFPIAAVVTSREIANCLPEYMNTYG
GNPLACAIGKAVLEVIVNEKLMYSAKMVGKSLLEGLRGLMSKHPSIGDVRGMGLCVGVEV
VCGRPDMKPATILANRILYLLKEEKVIVATQGEERNVIALTPPLCFTLDNARRVVEAFDK
AFTKANQSEESEPVRPNTSFLGLDNIPLNVMGGDEETDTSPAKRQRTYEEMD
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggtcttcatcagttttcaacgccatctgacaattggtgtcaggtccattttgcg
aacagtgaaatcaaagttgcaagggcctccaaacaatatatttatgatgatttaggaact
gaatttcttgattgtgttagcagctctgctcatgtcggccactgccatccacatgttgtt
gccgcaagtcaaactcaaatgcaaaagctgtggaccactcaaggatttctaaatgacact
tattcactttatatgaaaaagctgatggatgttcttcctgagtccctctcagttgtatac
ctcgtaaactcagggtctgaggctaacgatctcgcgttgaggcttggtcgtttgtatact
aaaagagacgatgtagctgtctttgagagtagctaccatggaaatatatccagcttggta
gatgtaagcagcaaatcatttaagagattgcctcaagggaagaaagaatttgttcacgtc
attccacttccgaaatgtcaaaacatcgaagatcagacagtcgagaatgaacaagcaaat
caagaaaaatattgcgaagatgctcaaagggtaattgaaaacgcttcgaaaaatggacga
ccaattggcatccttttgtcagaaatggtcatatcagcagctggattggtgataccacct
ttgggctacttcaaaaacctctaccagatgattcgaaaccaaggaggtatttgcattgca
gatgaagtgcagacaagtttaggtcgcattggaggagatttttgggcgttccagttgtat
ggtgtcgtgccagatattctcacctttggaaaatccataggaaatggttttcccattgct
gccgttgtaacatcgagagagatcgcaaattgtttgccagagtatatgaatacgtatggg
ggaaatcctttggcgtgcgcaattggtaaagcagtcttggaagtgattgtcaacgaaaag
ttaatgtattcggcaaaaatggttggtaaatcccttttggaaggactgagaggattgatg
tcgaagcacccaagtatcggagatgttcgtggaatgggtctttgcgtcggtgtggaggta
gtttgtggacgtccagatatgaagcctgcgacgattctagctaatcggattctttatttg
ttgaaagaagaaaaggtgattgttgctacccaaggggaagaacgtaatgtaatcgcccta
actccaccactatgctttacgttggacaatgcccggcgtgtcgttgaagcattcgataag
gctttcacgaaggccaaccagagtgaagagtcggaaccagtaaggcctaatacgtctttt
ctcggactggataatattccgctcaatgtgatgggaggtgacgaagaaacagatacgtct
cctgctaaaagacagagaacctatgaggaaatggactaa

DBGET integrated database retrieval system