KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_212927Help
Entry
DAPPUDRAFT_212927 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx00350  Tyrosine metabolism
dpx00360  Phenylalanine metabolism
dpx00380  Tryptophan metabolism
dpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    DAPPUDRAFT_212927
   00360 Phenylalanine metabolism
    DAPPUDRAFT_212927
   00380 Tryptophan metabolism
    DAPPUDRAFT_212927
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpx04147]
    DAPPUDRAFT_212927
Enzymes [BR:dpx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     DAPPUDRAFT_212927
    4.1.1.105  L-tryptophan decarboxylase
     DAPPUDRAFT_212927
Exosome [BR:dpx04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DAPPUDRAFT_212927
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 Beta_elim_lyase SepSecS Aminotran_5
Motif
Other DBs
NCBI-ProteinID: EFX78901
JGI: Dappu1_212927
UniProt: E9GNS5
Position
Unknown
AA seq 475 aa AA seqDB search
MDSQQFRAAAHQMIDYVIDYLDNIRNRRVLPIVQPGYLRGLIPEEAPEQGETWQSIFQDI
ERVIMPGVTHWHSPSFHAYYPTGNSWPGILADILSDAIGCVGFSWVASPACTELEVVMMD
WLGKLIGLPPVFLAGSGGKGGGVIQGTASEAMLVGLLAARSKTLKRLNAENPEDDEKMLA
SRLVAYSSDQSHSAAERAGLLAGVNVRVIPTDDEFHLRAVALKSAIDEDVANGKIPFFVI
ATLGTTPSCSFDNIEELGPVCNEKQLWLHVDAAYAGSAFICEEYRHYMKGIERADSFNFN
PHKWLLVNFDCSAMWFKDSDDIVSAFNVDPLFLKHDHQNSAPDFRHWQIPLGRRFRSLKL
WFVMRSYGAEGLRGYIRKQVKLAEEFHQMLSLNDRFEFPVPPAMGLVCFRLKGENSLSES
LLKRINDNGQVYMIPAKLHDTYIIRFAVCSRYTELSDIQASCEEICRHANDVVPQ
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggactcccaacaatttcgcgcagctgcccatcaaatgattgactacgttatagattac
ttggataacattcgcaataggcgagttttaccgatagttcagcctggatatttgcgcgga
ctcattcccgaggaagctccagaacaaggagaaacatggcaatccatatttcaagatatc
gaacgtgtgattatgcccggtgtcacacactggcactcaccaagtttccacgcttattac
ccaacgggcaattcatggccgggcattttagccgacatactgagcgatgctataggatgc
gttggtttttcatgggttgctagtccagcttgcaccgaacttgaagtagtaatgatggac
tggctgggcaaattaatcggtttacctcccgtctttctcgctggctccggtggtaaaggt
ggcggtgtcattcagggaacggctagcgaagcaatgctggtaggactcttagctgcccga
tcaaagactctaaaaaggctcaatgctgaaaaccctgaagatgacgaaaaaatgctggct
agtcgattagtagcgtactcctcggatcaatcacattcagctgctgaaagagcgggactc
ctggccggcgttaacgtccgcgtcattcctaccgatgatgaatttcatctgcgtgctgtc
gcactgaaatctgccatagacgaggacgtagcaaatggcaaaattccattctttgtgatt
gccacactcgggacaaccccttcttgctctttcgacaatattgaagagctgggccccgtg
tgcaacgaaaagcagttgtggttacacgtcgacgcagcttacgcaggttcggctttcatc
tgcgaagagtatcgtcactatatgaaagggattgagcgagccgattcatttaactttaac
ccacacaaatggcttcttgttaactttgactgttctgccatgtggttcaaggattcagac
gacattgtgagcgctttcaacgttgacccccttttcttaaaacatgaccaccaaaatagc
gccccagatttccggcactggcaaatcccccttggtcggcgattccgttccttgaagctt
tggttcgtgatgcgttcgtatggggctgagggactaagaggctacattcggaagcaagtt
aaactagccgaagaatttcatcaaatgttatcgttaaacgaccgcttcgaatttcctgtt
cctcctgctatggggctcgtctgcttccgactcaagggagaaaatagcttaagtgaatcg
cttttgaagcgcatcaacgataacggccaagtatacatgattcctgctaagctgcacgat
acgtacatcattcgcttcgctgtttgctcacgctacactgaacttagcgatattcaagct
tcttgtgaagaaatctgtcgccatgccaacgatgttgtgccacagtag

DBGET integrated database retrieval system