KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_213299
Entry
DAPPUDRAFT_213299 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx00100  Steroid biosynthesis
dpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    DAPPUDRAFT_213299
Enzymes [BR:dpx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     DAPPUDRAFT_213299
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT
Other DBs
NCBI-ProteinID: EFX77655
JGI: Dappu1_213299
UniProt: E9GS64
Position
Unknown
AA seq 187 aa
MQMIFALEALWNDTHLFHSFDFNQVKIGWMYLTMNTYPLATFLITLSAINSGLELSYFVL
APIGILFLIGLWIKAGSNSQLAAFIENPEHPSFSNMESLTSSSGKLLISGWWGWLRHPNF
LGDIILHWAFVLPCGYGMFLPYAVAIFTTVCFVYRTKESDLAGKLKYGPSWDRYCQRVPS
RVIPRVF
NT seq 564 nt   +upstreamnt  +downstreamnt
atgcaaatgattttcgctcttgaagctctttggaacgacactcatctctttcacagcttc
gactttaatcaagtgaagattggctggatgtatttgacgatgaacacttatcctctcgcg
acattcctcataacactcagcgccatcaactctgggctcgaattgtcatattttgtactt
gcgccaatcggaattctatttttgattggactttggattaaagcgggaagcaactcgcaa
ctcgcagcctttattgagaatcctgaacatccctcgttttccaacatggaaagtttaact
tcctcatccggaaagctactcatttctggctggtggggatggttacgtcatccaaatttc
ctcggagatataatcttgcactgggcgttcgtgttgccatgcggttatggtatgttccta
ccttatgcggtggcgatatttaccactgtttgttttgtttaccgaacaaaagaaagcgac
ttggccggaaaactgaagtatggaccatcttgggatcgatattgtcaacgcgtgccgtct
cgtgtaattccacgggtgttttaa

DBGET integrated database retrieval system