KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_221703Help
Entry
DAPPUDRAFT_221703 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K10799  tankyrase [EC:2.4.2.30]
Organism
dpx  Daphnia pulex (common water flea)
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:dpx03032]
    DAPPUDRAFT_221703
   03036 Chromosome and associated proteins [BR:dpx03036]
    DAPPUDRAFT_221703
Enzymes [BR:dpx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     DAPPUDRAFT_221703
DNA replication proteins [BR:dpx03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     DAPPUDRAFT_221703
Chromosome and associated proteins [BR:dpx03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     DAPPUDRAFT_221703
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PARP Ank_2 Ank_3 Ank Ank_4 SAM_2 Ank_5 SAM_1
Motif
Other DBs
NCBI-ProteinID: EFX87441
JGI: Dappu1_221703
UniProt: E9G089
Position
Unknown
AA seq 700 aa AA seqDB search
MATRRSTSSINTAIDLLATSPCDPLRELFEACRNGEVSKVKKLVTTQNVNARDTAGRKSS
PLHFAAGKIPLDVADATTRPVLTGHSLLEAARQADPTRLKKFLSVDVIGFKHPYTGDTAL
HCAVASTGVKRKHVVEILLKKGAAPNEKNKELHAPLHIAADKEHLDVLEALLRHGAKVNV
LDGLGQTALHRSSQKGQVPVCRLLLPYGADPTVVSLQGYTAAQVATESVQKLFAEQPAFN
ATPPPVDLEYQLLEAAKAGDLDNDAMTQHLPPTASSSPVSPVFNPSPRGSSIVIGCSSGS
SGNTAGASANPSTSSDTLVLPSGNAVVIAPPCPSPGLAPLPLLMLGPDSPGLAAASNTSV
PVSSSGAQIGDGCSDNDVPEQIQTTATTTSASTIVSFLSSLGLEHLREIFDREQVTIDIL
LEMGHEELKQIGVHAYGHRHRLLKGVEKFYSQLAVSASNPGSGWNSAGLGPSGSSSSSSN
QTTGTMLIDLSTEDQEYLTVEEELQSTIREHKDNGHAGGIFSRYNVLKIQKVRNRRLWER
YCHRRREVADENGGQSNERLLFHGSPFVHAIVQKGFDERHAYIGGMFGAGIYFAENSSKS
NQYVYGIGGGTGCPSHKDRSCYSCHRQLLLCRVTIGKSFLQFSAMRMAHAPPGHHSIVGR
PSTGGLTYPEYVVYRGEQAYPEYLISYQIVRPPEELTDKN
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgagaaggtctacctcctcgataaataccgccatagatctacttgcgaccagt
ccgtgtgatcctcttcgtgaattgttcgaagcttgtcggaacggagaggtttctaaagtc
aaaaagttggtaactacacaaaatgttaacgcccgtgatacagctggaagaaagtcgtct
ccactccacttcgccgcaggaaaaattcctctcgatgtagctgacgccacaacacgaccc
gtgttaactggacatagtttactggaagcggctcggcaagcggatccaactcgtctcaag
aaattcctctctgtggacgtcattggattcaagcacccgtacacgggagacactgccctt
cattgtgccgtcgcctccaccggagtcaaacggaagcacgtcgtcgaaatccttttgaag
aaaggggccgcgcctaacgagaagaacaaagagcttcacgcgccgctacacattgccgcc
gacaaggagcacctggacgttttggaggctctcctgcgtcacggtgccaaagtcaatgtg
ttggacggccttggtcaaacggccctgcaccgaagcagtcaaaaaggacaagtgccagtg
tgtcgactgcttcttccatacggcgccgatcccacggtcgtctctcttcagggttacacg
gccgcccaagtggctaccgaatctgtgcagaagcttttcgccgagcagccggccttcaat
gccacccctccgccagtcgatctcgaataccagttgctagaagcggccaaagccggggat
ttggataatgacgccatgactcaacaccttcctccgacagccagttcgtcgcccgtctcg
cccgtcttcaatccttcaccacgaggatcgtctattgtcattggctgctcgtctggaagc
agcggcaacactgccggcgcctctgccaacccatcgaccagttcagataccttagtcctg
ccttccggaaatgccgtcgtcatagcgcctccctgtccgtcgcccggcttagctccttta
cctctcctgatgctcggcccggattcccccggcttggctgctgcttccaatacctcggtg
cctgtatcttctagtggagctcagattggcgacggctgctcggacaatgacgttccggag
cagatccaaaccactgcgactacaacgtccgcctctacgattgtctcgttcctttccagc
ctgggactggaacacttgcgcgagattttcgatcgtgagcaagtgactatcgacatctta
ttggagatgggccacgaggaattgaaacaaattggagttcacgcttacggtcaccgccat
cgactcctcaaaggtgtagaaaaattctacagccaattggccgtttcagcctcgaatccc
ggaagcggttggaattcggctggtttgggaccatctggtagctcgtcttcgtcgtcgaac
cagacgacgggcacgatgctgattgacttgagcaccgaagatcaggaatatctcacggtg
gaggaggagcttcagagtacgatccgagaacacaaggacaacggtcacgctggcggcatt
ttctctcgctacaacgttcttaagatccaaaaagtacgcaatcgtcgattgtgggaacga
tattgtcaccgacgtcgggaagtagccgatgagaacggcggacagagcaatgaacgactc
ctcttccacggatccccattcgttcatgctatcgttcaaaaaggatttgacgagcgacat
gcctatattggaggaatgttcggagcagggatctattttgcggagaattcctcgaaaagc
aatcagtacgtctacggcatcggcggcggtactggttgcccctcacacaaagatcgatcc
tgctattcttgtcatcgccagctgcttctctgtcgtgtaacgattggcaaatctttcctg
cagttcagtgccatgcgtatggcccacgctcctccaggtcatcactcgattgtcggccga
cccagcaccggaggtctaacctatccggaatatgtcgtttatcgaggcgaacaggcctat
ccggaatacttgatatcataccagattgtccgtcctccggaagagctcactgacaagaac
taa

DBGET integrated database retrieval system