KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_231546Help
Entry
DAPPUDRAFT_231546 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx00480  Glutathione metabolism
dpx00980  Metabolism of xenobiotics by cytochrome P450
dpx00982  Drug metabolism - cytochrome P450
dpx00983  Drug metabolism - other enzymes
dpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DAPPUDRAFT_231546
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    DAPPUDRAFT_231546
   00982 Drug metabolism - cytochrome P450
    DAPPUDRAFT_231546
   00983 Drug metabolism - other enzymes
    DAPPUDRAFT_231546
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:dpx02000]
    DAPPUDRAFT_231546
Enzymes [BR:dpx01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     DAPPUDRAFT_231546
Transporters [BR:dpx02000]
 Other transporters
  Pores ion channels [TC:1]
   DAPPUDRAFT_231546
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-ProteinID: EFX71232
JGI: Dappu1_231546
UniProt: E9HAN8
Position
Unknown
AA seq 151 aa AA seqDB search
MSLYTSDNPVFASFSFYAALLGAKTLLMALLTARQRFRKMVSAFANPEDAKMNKGKIKTD
DDVERVRRAHLNDLENILPFLIIAFVYVGTGPSLGCAKFLFRLFTAARFMHTLVYAVFVI
PQPARAFAFFGGIIANLYMIYAIVTSYALAF
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgtacacatcggacaatcccgtctttgcctctttcagcttctatgctgctttg
ctgggagcaaagacactattgatggccctccttactgcccgtcagagattccgtaagatg
gtaagtgcatttgctaacccagaggacgccaagatgaacaagggtaaaatcaaaactgat
gatgacgtcgaacgagtacgacgagctcatttgaatgacttggagaatatcctgccattc
ctcatcattgcattcgtctacgttggaactggcccgtctttgggttgtgccaaattttta
ttccgtttattcactgctgccaggttcatgcacactttggtctatgcggtctttgtcatc
ccacaacccgcaagagctttcgcctttttcggtgggataatcgccaatttgtacatgatc
tacgccattgtgacctcttatgctttggcattctaa

DBGET integrated database retrieval system