KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_240087Help
Entry
DAPPUDRAFT_240087 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx00670  One carbon pool by folate
dpx00790  Folate biosynthesis
dpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DAPPUDRAFT_240087
   00670 One carbon pool by folate
    DAPPUDRAFT_240087
Enzymes [BR:dpx01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     DAPPUDRAFT_240087
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: EFX83481
JGI: Dappu1_240087
UniProt: E9GAU4
Position
Unknown
AA seq 202 aa AA seqDB search
MDTSEIEFPRLELMVATDLKLGIGKGNKMAWHLPTEFSYYRRMTTCANGSEKVHASIFAT
KTWQSIPPEMKPWGNTICFILSRSMTEDDVRNYSDVYVHSSLEEIIAHMRQTDMRKRIDR
VWMHGGGFGYKEALRSKHFYRLYHTKIDAEFSCDVFFPRYDECQLQIVDDPDVPQGIQLD
RGVSYQIHVYETTGVCPLLDAP
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggacacatcggaaatcgaattccctcgactggaactaatggtcgcaaccgatttaaaa
ctgggaattggaaagggaaataaaatggcctggcacctgccaaccgaattttcctactat
cgacggatgactacgtgcgcaaatggatcggaaaaagtgcacgcctccatattcgctacc
aagacctggcagtccatcccaccggaaatgaaaccttggggcaataccatatgtttcatt
ttgagtcgctccatgacggaagatgatgtgcgaaactacagcgacgtctacgtccattca
agtcttgaagaaatcattgcccacatgcgtcaaacagatatgagaaaacgcatcgatcgg
gtctggatgcacggaggagggtttggctacaaggaggcccttcgttcaaagcatttctac
cgattgtaccataccaagatcgacgctgaattttcgtgcgatgtgtttttccctagatac
gacgaatgccaactccaaatagttgacgatcccgatgtccctcaagggattcaactggac
cgcggcgtcagttatcaaatccatgtctatgaaactactggcgtttgccctttactcgat
gctccttga

DBGET integrated database retrieval system