KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_300721Help
Entry
DAPPUDRAFT_300721 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K23341  erlin
Organism
dpx  Daphnia pulex (common water flea)
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:dpx04121]
    DAPPUDRAFT_300721
Ubiquitin system [BR:dpx04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    DAPPUDRAFT_300721
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7
Motif
Other DBs
NCBI-ProteinID: EFX84809
JGI: Dappu1_300721
UniProt: E9G6V1
Position
Unknown
AA seq 325 aa AA seqDB search
MPPSVGSFAILIGTLAVLFNFSLHKIDEGYVGVYYRGGALLKETSNPGYHMMFPFLTTHR
SVQVTLQSDEVKNVPCGTAGGVMLYFDRIEVVNILSPSSVYEIVKNYTADYDRTLVYNKI
HHELNQFCSVHTLQEVYIDLFDQIDENLKKALQADLNDLAPGLHIHGVRVTKPKIPESIR
KNYELVEAEKTKLLIAREYQKVVEKDAETERKKAVIEAEKEAQVAKINFEQKVMEKESVK
TMSIIEDEIVTNRHKSRADADYYSLERQAKANELLLTKEYLELKRYESITANTKLYFGAN
IPTLFMGDQQPSSGSLPVVTEKAAN
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgccgccttcagttggatcgtttgctattttgatcggaactttagccgtcctgttcaat
ttttctttacacaaaatcgatgagggatatgtcggtgtttattaccggggaggtgcattg
ttgaaagagacaagcaatcctggatatcatatgatgtttccttttcttactactcaccga
tcagttcaggtaactctgcaatcagacgaagtaaagaatgtaccgtgtggaactgctggc
ggggtcatgctttactttgaccgtattgaagtggtcaatattttaagtccatccagtgta
tacgaaattgtcaaaaactatacagccgactatgatagaacgctagtatacaacaagatc
catcacgaacttaaccagttttgttctgtgcatactctacaagaggtctacattgatctg
tttgatcagatcgacgaaaatttaaagaaggccttgcaagcagatttgaatgatcttgca
ccgggtttgcatattcacggcgtgcgcgtcaccaaacccaaaattcctgaatctattcga
aagaactacgaacttgtggaggcggagaaaaccaaattgttgattgcacgagagtatcag
aaagtggttgagaaagacgccgaaaccgagcggaagaaagccgttattgaagccgagaaa
gaagctcaagtggccaaaattaattttgaacaaaaagtgatggagaaagaatcagtcaag
accatgtctatcattgaagatgaaatcgttaccaaccgacataagagtcgcgcagatgca
gattactactcgcttgagcgacaagctaaggccaatgagttgctattgacgaaggaatat
ctggaactcaagcgctacgaatccattacggccaatacgaagctatatttcggagccaac
attccaacacttttcatgggcgatcaacagccttctagtggcagtctaccagtagtaacc
gaaaaagccgcgaattaa

DBGET integrated database retrieval system