KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_301125Help
Entry
DAPPUDRAFT_301125 CDS       T04347                                 

Definition
(GenBank) polo kinase-like protein, copy B
  KO
K06631  polo-like kinase 1 [EC:2.7.11.21]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    DAPPUDRAFT_301125
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dpx01001]
    DAPPUDRAFT_301125
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dpx03036]
    DAPPUDRAFT_301125
Enzymes [BR:dpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     DAPPUDRAFT_301125
Protein kinases [BR:dpx01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   DAPPUDRAFT_301125
Chromosome and associated proteins [BR:dpx03036]
 Eukaryotic Type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     DAPPUDRAFT_301125
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    DAPPUDRAFT_301125
  Sister chromatid separation proteins
   Polo kinases
    DAPPUDRAFT_301125
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase POLO_box Pkinase_Tyr Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-ProteinID: EFX84439
JGI: Dappu1_301125
UniProt: E9G7B9
Position
Unknown
AA seq 586 aa AA seqDB search
MTSIKPSEPGPDIIPDILCDAAGKKRYQRGRFLGKGGFAKCYELTDLDNGQVFAGKIVSK
QLLVKPHQKDKMAQEISIHRSLKHDHVVGFHSFFEDNNFVYIVLELCKRRSLMELHKRRK
AVTEPEARYFMHQLLLGVKYLHENKMIHRDLKLGNLFLNDNMELKIGDFGLATKLDFSGE
RKKTLCGTPNYIAPEVLNKKGHSFEVDIWSMGCILYTLLVGRPPFETQSLKDTYSKIKRN
EYHIPSRIGPLARALITRMLQGDPTCRPAVDIVLNDEFMTCGYMPTRLPLSCLTMAPRFD
AKLNSSIIAVRRPLGEVNRVHLPGTAEHPQGDGLAPSNEPNHAENAGALYTAGPSPEKLL
RELQQQLTRLFSAKPAEKFPLMMDEAEDPGSVPMVWISKWVDYSDKYGFGYQLSDDTIGV
IFNDLTKLLLLVDAKTIQYVERNGNELYYTMDQHPPTLGKKVKLLAYFRSYMQEHLIKTG
ASVVPRDGDEHLRLPFLRQWFRTSRAVVMHLTSGTLQINYFKDHVKLILCPLMGAVTVID
EKKNFRTFKFSLLAEHGCNPDLLYRLQYAHEKLPFLLSPLVDTQEK
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcattaaaccaagtgaaccgggacctgatattattcccgacatcctgtgtgat
gctgctggcaaaaagaggtatcaaagaggaagatttctcggcaagggtggttttgccaaa
tgctatgagctaacagatcttgacaatggacaagtgtttgctggaaaaatcgtctccaaa
caacttcttgtcaagcctcaccaaaaagataaaatggctcaggaaatttctattcatcgt
agtctgaaacatgatcatgtagtaggatttcacagtttctttgaagataataactttgta
tatatagtgttggaactgtgcaaaagaaggagtctaatggaattgcacaaaagaaggaaa
gctgttactgaaccagaagcaagatatttcatgcaccaacttctattgggtgtaaaatac
cttcatgaaaacaaaatgattcacagggatctcaagcttgggaacttgttcctgaatgat
aacatggaacttaaaattggagattttggtctggcaacaaaattagattttagtggagag
agaaaaaaaacattgtgtggcactcccaactatattgctccagaggttctcaacaaaaaa
ggccatagctttgaagttgacatttggtcaatgggctgcattttgtatactttacttgtt
ggtcgtccaccttttgagacgcagtctctcaaagatacttacagtaaaatcaaacgaaat
gaatatcatattccctctcggatcgggcctcttgcccgagctcttataactcgaatgtta
cagggtgatccaacctgcagacctgcggtcgatatcgttttgaatgacgaatttatgacg
tgtggttatatgcctacacgcttgcctttatcatgcctcacgatggctccgagattcgat
gccaaattgaatagcagcattattgctgttcgtcgtccattgggcgaagttaacagagtc
catttacctggaactgcggaacatccacaaggagatggattggcgccttcaaacgaaccc
aaccatgctgagaatgccggagccctctacacggctggaccttctcctgagaaactattg
cgtgagcttcagcaacagcttacccgcctcttcagtgcaaaacctgcggagaagttccct
cttatgatggacgaggcagaggatccgggttcagtgcctatggtatggatttctaaatgg
gtagattattctgacaaatacgggttcggctaccaactcagcgatgatacaattggtgtc
attttcaatgatttgacgaaacttttgctgttggttgacgcaaagaccattcagtacgtc
gaacgcaatggaaatgagttgtattacactatggatcaacatccacctaccttgggtaaa
aaggtgaaactgctcgcatatttccgatcttacatgcaagagcacttaatcaagactggt
gcatccgttgttccacgtgacggtgatgaacatcttcggttgcctttcctacgtcagtgg
ttccgcacatctcgagctgtcgtcatgcacctaacgagtggaacgctacagattaattac
tttaaagaccacgttaaattgatcctctgtccactcatgggagctgtgacagtcatcgac
gagaagaaaaatttccgtaccttcaaattttctttgctggctgaacacggttgcaatccc
gatctcttatacagactgcaatacgcacatgagaaactgccatttttactctcaccatta
gtagatactcaggaaaaatag

DBGET integrated database retrieval system