KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_303407Help
Entry
DAPPUDRAFT_303407 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K03000  DNA-directed RNA polymerase I subunit RPA12
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx03020  RNA polymerase
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09120 Genetic Information Processing
  09121 Transcription
   03020 RNA polymerase
    DAPPUDRAFT_303407
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:dpx03021]
    DAPPUDRAFT_303407
Transcription machinery [BR:dpx03021]
 Eukaryotic type
  RNA polymerase I system
   RNA polymerase I
    Pol I specific subunits
     DAPPUDRAFT_303407
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIS_C DZR zinc_ribbon_2 NOB1_Zn_bind zf-ribbon_3 Zn_Tnp_IS1595 Baculo_LEF5_C preSET_CXC CpXC
Motif
Other DBs
NCBI-ProteinID: EFX81535
JGI: Dappu1_303407
UniProt: E9GG94
Position
Unknown
AA seq 122 aa AA seqDB search
MAAITQFNCDPQFCPRCGAILPILGTAGGVMCIVCKFEIDIQVMEEVRVDYNIDFNKRSD
YIEEQQLKSAQSKTDGPLVERKCSKCGNETMSYASLQLRSADEGQTIFYTCTKCQHKETE
NS
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagctattacacaatttaactgtgatccacaattctgtccacgttgcggtgccata
ttacctatcttgggaaccgcgggtggagtcatgtgtattgtttgcaagttcgagatagat
atccaagtcatggaagaagttcgagtggattacaacattgatttcaataaaagaagtgac
tacattgaagaacaacagttgaagtctgcccagagcaaaactgatggcccacttgtagag
cgcaagtgcagcaagtgtgggaatgaaaccatgtcttatgcatcacttcagttgcggtct
gctgatgaaggccaaaccattttctacacctgcaccaagtgtcaacacaaagaaaccgaa
aactcttga

DBGET integrated database retrieval system