KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_304493Help
Entry
DAPPUDRAFT_304493 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
dpx  Daphnia pulex (common water flea)
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:dpx01002]
    DAPPUDRAFT_304493
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpx04147]
    DAPPUDRAFT_304493
Enzymes [BR:dpx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     DAPPUDRAFT_304493
Peptidases [BR:dpx01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   DAPPUDRAFT_304493
Exosome [BR:dpx04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   DAPPUDRAFT_304493
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 LIP Abhydrolase_3 DUF900 Lipase_3 XdhC_C Cutinase DUF676 Abhydrolase_5
Motif
Other DBs
NCBI-ProteinID: EFX79647
JGI: Dappu1_304493
UniProt: E9GLP5
Position
Unknown
AA seq 330 aa AA seqDB search
MQIIGLILFILYVCLPLAFRFLPTFQRHMVFLPYVRWPFGVDFADPESQGLSGARNLYLE
TDADVKVGVWHILPESVMDAKFETPEDSFSSGHPIILYLHGNSGSRAGSHRIELYKILQS
LNYHVVTMDYRGYADSTQAHMSEDGVITDATAVYNYIKKHSKDAMIVVWGHSLGTGVASR
TVGQLCSEKRSPDRLILEAPFNNIRDEIRNHPLSYIFRPIPAFDWFFTEPLVANDLAFDS
DLHIPKIDSPILILHAQDDAVIPIILAKKLYEVALNKRPADWPPVQFVEFHYNFGYAHKY
ICRAPELPSIIQEYIDSSLDTRKSGKQLIA
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcagattataggcctaattttgttcattctttatgtttgccttccattggcatttcgc
tttttgcctactttccaaaggcatatggtgttcttaccatatgttcgatggccttttggg
gtggactttgctgacccggaatcccaagggttgagtggagcacgtaatctgtacttggag
actgatgcagatgtcaaagtgggagtttggcacatattgccagagtctgtgatggatgca
aagtttgaaacaccagaagattccttttcttcaggccatcccattattttataccttcat
ggaaattcaggctcaagggcaggcagtcaccgaatagaactgtataaaatcttgcaatct
ttaaactaccatgtggtcactatggactatagaggatatgctgactcaactcaggcccat
atgtctgaagatggtgtcattactgatgcaacagctgtctacaattacataaagaaacat
tctaaggatgccatgattgttgtgtggggccattcacttggtactggtgttgcttcaaga
acggtgggacaactttgcagcgagaaacggtctcccgataggctaattttggaagctccc
ttcaacaacattcgagatgagattcgaaatcatccactttcatatatcttccgtcctatc
cccgcattcgattggtttttcaccgaacctctagtcgccaatgatcttgcctttgatagc
gacttgcatattcccaaaatcgacagcccaattctgattctacatgctcaggacgatgcc
gtgatccccattattcttgccaaaaagctttacgaagtagcgttgaacaagcgtcctgcc
gattggcctccagtacagttcgtagaatttcactacaactttggatatgctcacaaatat
atttgcagagctccagaactgccgtcgataattcaggaatacatcgattcaagtctagat
acgagaaaatcaggaaagcaactaattgcatag

DBGET integrated database retrieval system