KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_305651Help
Entry
DAPPUDRAFT_305651 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K00736  alpha-1,6-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase [EC:2.4.1.143]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx00510  N-Glycan biosynthesis
dpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    DAPPUDRAFT_305651
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dpx01003]
    DAPPUDRAFT_305651
Enzymes [BR:dpx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.143  alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
     DAPPUDRAFT_305651
Glycosyltransferases [BR:dpx01003]
 Glycan extension
  N-Glycan
   DAPPUDRAFT_305651
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MGAT2
Motif
Other DBs
NCBI-ProteinID: EFX88329
JGI: Dappu1_305651
UniProt: E9FX39
Position
Unknown
AA seq 362 aa AA seqDB search
MPILNLGTIWKLLLQVHNRISYLRKLLRSLSQAAWIERALIIFSHNIYSEELNDIIQSIP
FAAVMQIHFPYSTQLFPYSFPGDSPSDCPRDINKERAIAVGCSNAQTPDLYGHYREARYS
QTKHHWWWKVNFIFGKIRALRDYNGPVVFMEEDHYVAEDFLHILWLQQKLLNGGSDCSFC
NQAHILSLGSYPKYFNHREASNMVDLLPWSSSKHNMGMAFNRSVWINFQQCSELFCSVDD
YNWDWSLLHVAQQCLPKLFGDPTNLKMKSKFILGALVLKAPRVFHIGECGVHHRKANCGT
DTSTLRKAETSLRSARKAQTLFPSTLKTKNMLGTKGIRLKKGNGGWGDPRDRELCLSLTI
FD
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcctatacttaatttgggaacaatttggaaattacttttacaggtgcacaatcgaata
tcttacttaaggaaattacttcgaagtctatctcaagccgcatggatagagagagcccta
attatattttcacataacatttacagtgaagaattgaatgatattatccagtccattccc
tttgcagctgtgatgcaaatccatttcccttattccactcaactatttccgtactcgttt
ccgggagactctccctccgattgtccgagggatatcaacaaagagcgagctattgcagtc
ggttgcagcaacgcccaaactccagatttgtatggccattaccgtgaagcgcgctacagc
caaacgaaacatcactggtggtggaaagtcaacttcatattcggaaaaattagagctctt
cgcgattacaatggcccagtcgttttcatggaagaggaccattacgtcgctgaagatttc
ttacatattctgtggctccaacaaaaactacttaatggaggatctgattgtagcttctgt
aatcaagctcacatcttgtcactgggttcctacccgaaatactttaatcatcgtgaagca
tcgaatatggttgacttgttaccttggtcatcgagcaagcacaacatgggaatggcgttc
aatcgatcagtgtggataaactttcagcaatgctctgagttgttttgttctgttgatgac
tacaattgggactggagcctacttcacgttgcacaacagtgtttacctaagttattcggc
gatccaactaacctaaaaatgaaatcaaaattcattttgggagcgttagtcttgaaggct
cctcgcgttttccacattggagaatgtggagttcatcataggaaagcaaactgtggaact
gacacttcgacgttgcgaaaagcggagacgtcactgagatcggcgcgcaaggcccaaaca
ctttttccatctactttgaaaactaaaaatatgttgggcactaaaggtattcggttgaag
aaaggaaatggaggttggggagatcctcgtgatagagagttgtgcctatctctaaccatc
ttcgactag

DBGET integrated database retrieval system