KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_307583Help
Entry
DAPPUDRAFT_307583 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K11153  retinol dehydrogenase 12 [EC:1.1.1.300]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx00830  Retinol metabolism
dpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    DAPPUDRAFT_307583
Enzymes [BR:dpx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.300  NADP-retinol dehydrogenase
     DAPPUDRAFT_307583
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Sacchrp_dh_NADP NAD_binding_10 Glyco_transf_4 Glyco_trans_4_4 Shikimate_DH Glyco_trans_4_2
Motif
Other DBs
NCBI-ProteinID: EFX73751
JGI: Dappu1_307583
UniProt: E9H3E6
Position
Unknown
AA seq 303 aa AA seqDB search
MPRFFQGPRCKNAIGLDGKIAVITGANTGIGKETARELSKRGAEVVLACRDLNKAEEAAD
EIAKETGNKVTTLKLNLASLKSIRAAAEELRARHPQIHILINNAGIMTCPQWKTDDGFEM
QFGVNHLGSFLWTLLLLDNIKQAAPSRIVNLSSLAHTRGKIYFDDLMLGKNYTPVRAYCQ
SKLANVLFTQELARRLEGTGVSVFAVHPGVVQTELARHINESMNSCVDGTLHFVSRYVFK
TPEMGAQTSIYCATEESLTELSGHYFSDCAKKKPAKQANDKKAAERLWKMSEELVGLNYN
PSE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgccacgctttttccaaggtcctcgttgcaaaaacgcaattggacttgatggcaaaatt
gccgtgatcacgggagccaataccggcataggcaaagagacggcccgtgaactcagcaaa
agaggagctgaagtggttctcgcttgtcgtgacctgaacaaagccgaagaagctgcagac
gagattgcgaaggagacgggcaataaagtcacgactttgaaattgaatttagcttctctg
aaatcgattcgcgctgccgctgaggagctcagggcccgtcatccccaaattcatattctc
atcaacaatgcaggaattatgacgtgcccccaatggaagacggacgacggttttgagatg
caatttggcgtcaaccatttgggatcttttctatggactcttcttctgctagacaacatc
aaacaagctgcaccttctcgcattgtcaatctttcttctctcgcccacactagaggtaag
atttatttcgacgacctgatgttggggaaaaattacacgccagtacgagcatactgccaa
agcaagttggcaaatgtcctcttcacccaggaactcgctagacgactcgaaggaactggc
gtatccgtttttgccgtacatccaggcgtggtacaaacggaactggcgcgccacattaac
gaatcgatgaactcgtgcgttgatggcactcttcattttgttagtcgttacgtctttaag
acgccagaaatgggagcccaaacgagtatttactgtgccacagaggaatctttgacagaa
ctgagtggacattattttagtgactgtgctaagaagaaacctgcgaagcaagctaatgat
aaaaaagcagccgagcgcttgtggaaaatgagcgaagaattagttggtctcaattataac
ccatcggagtag

DBGET integrated database retrieval system