KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_309030Help
Entry
DAPPUDRAFT_309030 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K11592  endoribonuclease Dicer [EC:3.1.26.-]
Organism
dpx  Daphnia pulex (common water flea)
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dpx03036]
    DAPPUDRAFT_309030
Enzymes [BR:dpx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     DAPPUDRAFT_309030
Chromosome and associated proteins [BR:dpx03036]
 Eukaryotic Type
  Gene silencing
   RISC (RNA-induced silencing complex)
    DAPPUDRAFT_309030
   microRNA pathway
    RISC loading complex
     DAPPUDRAFT_309030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribonuclease_3 Dicer_dimer Ribonucleas_3_3 PAZ ResIII Helicase_C DEAD dsrm
Motif
Other DBs
NCBI-ProteinID: EFX86072
JGI: Dappu1_309030
UniProt: E9G444
Position
Unknown
AA seq 1607 aa AA seqDB search
MSKVRRVKSLNLTKNPIMESPSKSCNVDTEFTPRDYQIELFQAALDENIIVYLPTGSGKT
FIAALLIKEKSHEVTKPLDSGGKRTVFLVPTVVLAIQQAAYLRRHTYLKVKEFYGSMGVD
IWEKDRWNIEFDSNHVLVMTAQIFVDILNHAFFSPHQLNLLVFDECHAAVKDAPMKQVLS
KLKNCEVSQRPKILGLTAALFRMRCKPEKVPDLIQQLSETMGCVVRIPSDVETVARSSTK
PCETILQYEDKNSNPNPDADELSRIIFVMVSSLMQQLEQQYGEGNSKDGPDVNKQPDKID
VLFDALNDIDYLLSTIGPYGAFHCAHVYIRILERTKSRAKTAPFLTDLIRKQVCNGLNFI
ISEVCTPYFAKYSPVDRLLLFVQPRDIAKHDTTLEFLKPLFTMGKAAGRNSSLKETQILN
MKQNEIMQYFREGLCNLLVATSVLEEGIDIPDCNLIIRFDRIKTYCDYVQTKGRARSKKA
FYCILVSRGETESCLADLAQFHSIEQQLLSTGNFEDERDNAIDNLFSQIIPPYVPFGEDG
PRITLPSSISLINRYCGQLSSDPDVSLAPQLTTKKVAESDVDPIQLQKIKDILKKLPTDA
SKYSSINNLFQCHLFLPLNSPLRDEVIGDVMPTKRLAKRAVALKASIKLHELKELDDNHL
FPVPRLNVIDDESSTEDEENSAAPQLNKENIAVYNRRLPVCFSNCRPLPGQPCFVYAIDF
TLTKPCLDITKLYFPFAVDTKLAILTSKVIPAICPFPVVTRAGEFQVNLCGADSVILDQS
QLGKLERFHQFVFQDVLFLWKRQLDFDVLASDLQYLVVPLQTANDKIDFALVENMINAPA
INWEKPPYAGDHFIFDSSRLIDSVIVPSYKPLGTLNAFYVDRVSDLTPLTPFPNNEFKTY
ASYFQLKYKLTLTNQQQQLLQVSREISGKNFLVNRVASTREETPMHLVAELCHVHPLAGS
IWKQVVWLPCILHRLDRMLVAEELRVLVYKEANIGIEFLPGSVNVSSVWCPLRLRPQKSR
AESRCVADPTLLASTLKPSAFMDYLDLDVNMMWSFEYDESEKDLSPNQSSIEQTPAETFI
ATSSPKKPSELSLPNPGSYSAFKEFPDSIDEQRNKWTDLANGNPSDDLPTCPPETFNLKF
DSGNSGMLSNFGPSPGMILEALTLAKTHEGFDMERSETIGDSILKLVISIYVYGETGSDR
CDEGRLSLMRMRQINNKHLFKLGAKKDIGEFTVAQRFELMANFLPPGFKTPTDPDTDINA
HVQQYVLMKNVADCMEALIGVYLTTTGIKGAIKLMDWMGLKTVPRLEIATFNEMNGFPIL
PSTFGSSTLNDTQLKDQEEALSQLFAGLESFEKRLRYTFKNKALLIEALTHASYIPNRIT
NCYQRLEFLGDAVLDYLVTRYYYDNPCQYTPAILTDLRSAMVNNETFAVMAVQNRFHLYL
KHLSLSLNVILDRFVRSQEENGHLLMHNYFVLEETSEPHQSLASNIDVPKVLGDIFESVA
GAIFVDSGMSLDAVWKSYLPFLHDALEKFNEKIPISALRVLHERYPNALKFRKSESLADG
RLCVAIEIQGTRVFKGAGGNSKTAKSAAAKYALSVLNKQDDNQVEEC
NT seq 4824 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagtcagacgagtgaagagtctcaatctgaccaaaaacccaatcatggaatct
ccaagcaaatcatgtaatgttgatactgagtttactccaagggactatcagattgaactg
ttccaagcagcgttggatgaaaacataattgtttacctaccaactggttcaggaaagaca
ttcattgcagcccttctaatcaaagaaaaatctcatgaagtcacaaaaccgttggattca
ggaggaaaaaggacagtttttcttgtacccaccgttgtgttggctattcaacaggccgcc
tacttgcgacgccacacatatttgaaagttaaagagttttacgggagtatgggagttgac
atctgggaaaaagacaggtggaacattgaatttgattccaaccatgtcctggtgatgact
gctcaaatatttgtggacatcttgaaccatgcctttttctcacctcaccagctcaattta
ctggtcttcgacgagtgtcatgctgctgttaaggatgcaccgatgaagcaagttctttcg
aaactgaaaaactgtgaagtttcccagcgtcccaaaattcttggattgactgcagctctg
tttaggatgagatgcaaaccggagaaggtgcctgatctaatccagcaactctccgaaaca
atgggatgcgtggtcaggattccctctgacgtagaaactgtcgctcgctcttccaccaaa
ccgtgcgaaaccatcttacagtatgaagacaaaaattccaatccgaatccagatgcggac
gaattaagtcggattatttttgtaatggtgtcttcccttatgcagcaacttgaacaacag
tacggtgaaggcaattctaaagatggacccgatgttaacaagcagcctgacaaaatcgat
gtgttgtttgatgcactgaatgacattgactacctcctgagcacaataggaccgtacggg
gcttttcattgtgcccatgtctacattcgcattttggagcgtaccaagagtcgagccaag
accgctccatttttgacagacctaatcagaaagcaagtttgtaatggactgaattttatc
attagtgaagtttgcactccttatttcgccaagtattcaccggtggaccgacttttgctc
tttgttcagccgagagatatcgcgaaacatgacacaacattagaatttctgaagccattg
tttacgatgggcaaggcagcaggtcgaaactcatccctgaaagaaactcaaattctcaac
atgaaacaaaacgagattatgcagtattttcgtgaaggtctctgcaacttgctagtggcc
acttctgtcctggaagaaggcattgatattcctgattgcaatttaatcattagatttgat
agaatcaaaacttattgtgattatgttcagaccaaaggtcgggctagatcgaagaaagcc
ttctattgcatattagtgagtcgtggtgagacagaaagttgcctggcagatttagcccaa
ttccacagcattgagcaacagcttttgtccactggaaactttgaagacgaacgagataat
gccatagataacttgtttagtcaaatcatcccaccgtatgttccatttggagaggatggg
cctcgaattaccttaccaagcagcatatcgctcatcaacaggtactgtggtcaactatct
tctgatccggatgttagtttggctccacaactgactaccaagaaagttgcagaaagcgac
gttgatcccatccaattacagaaaatcaaggacatactaaagaaattaccgactgatgct
tccaaatattcatcgatcaacaatttattccaatgccatctcttccttccgttgaactct
cccttgagagatgaggtcattggagatgttatgcccacaaaacgtctagccaagcgagca
gttgctttaaaagcatccatcaagctccacgaactgaaagagctcgacgacaatcacctt
ttcccagtgccacgactgaatgtgatcgatgacgaatcgtcaactgaagatgaagagaat
tcggcagctcctcagctcaataaggaaaacatcgcagtatacaaccgacgtctgcctgtc
tgtttttccaattgccgccctcttcctggacagccttgcttcgtctatgcgattgacttc
acgttgaccaagccttgcctcgatatcactaaactctatttcccattcgcagtcgacaca
aaactggccatcttgacgtccaaagtcatccctgccatttgcccatttcctgtggtaacc
cgagccggtgaatttcaagtcaacttgtgcggagctgattcagtcatccttgaccagagt
cagctgggaaaacttgaacgatttcatcaattcgtcttccaggatgttctctttttgtgg
aagcgacagctggattttgacgtgctggcctctgacttgcagtacctggtggtccctctg
caaacggcaaacgacaagatcgactttgccctcgttgaaaatatgatcaacgccccagca
attaattgggagaaaccgccctacgctggagatcattttatctttgattcaagccggctc
atcgattcggttatcgttccgtcttataaaccgctgggcactctgaacgctttttacgtg
gaccgtgtttctgatttgacacccctcactccgtttcccaacaacgagtttaaaacgtac
gcatcttatttccagctcaagtacaaactcacgttgactaatcagcagcagcagcttctt
caagtcagtcgtgagatatctggcaaaaatttcctcgtcaacagagttgcttcaacaaga
gaagaaacgccaatgcatctagtggccgagttgtgtcatgttcatccactggccggatcc
atttggaaacaggtggtctggctcccttgcattctccaccgtcttgatcgcatgttggtg
gctgaagaacttcgtgtccttgtctacaaggaagccaacattggaattgaattcttacct
ggatccgtcaacgtttcttccgtttggtgccctttgcgacttcgaccccaaaagtctcgt
gccgaaagccgctgtgttgcagaccccacacttttggccagcactttgaaaccttccgcc
ttcatggattacttggatcttgacgtcaatatgatgtggagttttgagtatgatgaatcg
gaaaaagatctcagtccaaaccagtcttccatcgaacaaaccccggccgaaacattcatc
gctacatcctcaccgaagaaaccaagtgagttgagtttgcccaatcctggcagctattct
gcattcaaagaatttccagattcaattgacgagcaaagaaacaaatggactgatctggct
aatgggaatccgtcggatgacctaccaacttgtccaccggaaacttttaatctgaaattc
gattccggaaactccggaatgctctccaactttggcccttcacccggaatgatattagaa
gccctcacccttgccaagacgcacgaaggattcgacatggaacgttcggaaacgattggc
gactccattttaaagttggtcatatccatttatgtgtacggagaaacgggtagtgaccgc
tgcgacgaagggagactcagcctcatgcggatgcgccagatcaacaacaaacatctcttc
aagttgggcgccaaaaaggacattggggaatttactgtcgctcaaagattcgaactaatg
gcgaatttcctccctcctggattcaaaacgccgacggatcctgacactgacatcaatgct
catgtccagcaatatgtcctgatgaagaatgtggcagattgcatggaggctttgattggt
gtttatctgaccactactggaatcaagggtgccatcaagctaatggactggatgggattg
aaaactgttccccgactcgagatcgccaccttcaacgaaatgaatggattcccgatactc
ccgtcaacgtttggatcatccactttaaacgatactcaactcaaagaccaagaagaggct
ctatcgcagctctttgccggattagaatcatttgaaaagcgtctccgctatacattcaag
aacaaagctttgctgattgaagcgctaactcacgcctcctacattcccaaccggatcacc
aattgttaccagaggctggaattcctcggtgatgctgtgctagattatctcgtgacgcgg
tattactatgacaatccttgtcagtacaccccggccattctaacggatcttcgctcggcc
atggtaaacaacgaaacctttgctgtcatggcggtccagaaccgtttccacctctacttg
aagcatctttccttgtctttaaacgtgattctggatcgattcgttcgatcacaagaagag
aacgggcatctgctgatgcataattattttgttcttgaagaaaccagtgagccacaccaa
tccctggccagcaatattgacgttcctaaagtgttgggcgacattttcgagtcagtggca
ggtgccatatttgtcgattcgggcatgtcgctcgatgcggtgtggaaatcttacctaccc
tttttacacgacgcattggaaaaatttaatgagaaaattcccatttctgccctgcgagta
cttcatgagcgctaccctaacgccctcaaattcaggaaatcggaaagtcttgccgatggg
agattgtgcgtggcgatagaaatccaagggacgcgtgtgtttaagggcgctggcggtaat
tcgaaaacagctaaaagtgctgctgccaaatacgcactgagcgttctcaacaaacaggac
gacaatcaagtcgaagaatgttga

DBGET integrated database retrieval system