KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_319725Help
Entry
DAPPUDRAFT_319725 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx00230  Purine metabolism
dpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    DAPPUDRAFT_319725
Enzymes [BR:dpx01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     DAPPUDRAFT_319725
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HNOBA HNOB Guanylate_cyc PHA_gran_rgn
Motif
Other DBs
NCBI-ProteinID: EFX79269
JGI: Dappu1_319725
UniProt: E9GML8
Position
Unknown
AA seq 630 aa AA seqDB search
MYGMLLESVQHFIQLEYGEETWLAILESVGYRNTVFRTHHIYPDELIMKLADAAVTLVAN
GSTRQDFLRFFGRCFVRYFSHYGYEKFIKVCGRYFCDFLTGIDNIHLQMRYMYPKMVSPS
MYISHEDAEGVLLHYRTTRNGFCPYLIGQLHQIAHDFYGIQLAVEELPKTPFNKEEGYQF
RFRLNFDNRDYMTGRSACNGSLELGRINISSRGSVSTTASEKALASLSSSILMQLFPFTL
VFRPDLQIIAVGRQLKQMFPDNALVGQALPDVARVRRPKLLFTWDNLYSLQKVLCEMELL
PAIRTARKNARHLAASKADSNAVANKEAKEENRRLMLQGQLRYLSDWNAMIFLCNPLINN
LEDMDGMGLTINDLSLHGHGRDMVMAGWQHNSRLEDMYERAEERSQQLQQTYELQDEWKK
RGDKLLYSMIPQSVADILRSGTDPVDTCQAFESITVLFVELANIDEITATNPMEAVSCMN
AVFSCFDNIIDQHNVYKVETVGKVYMVVGGAPETNETHVKDVAMGILQMVKDTKMSVHIR
IGFHTGSAVAGVVGKKMPRYCFFGDTINTAARMQTTSLPGKIHISQNSFCRLHNFNGFVF
EMRGTVFVKGKGDMKTHWLLRYQVPDGNST
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcatgctactagaatcggtacaacattttattcagctcgagtacggtgaagag
acttggctggccatcttggagagtgtcggctaccggaacactgtcttccgtactcaccac
atctacccggatgaactgatcatgaaactggccgacgctgccgtcacgctcgtcgccaac
ggctcaacgcggcaggactttctgcgctttttcggtcgctgtttcgtccgctacttcagc
cactacggctacgagaaatttattaaagtttgtggccgctacttctgtgacttcctgacc
ggcatcgacaatatccatttgcaaatgagatacatgtatccgaaaatggtttcccccagc
atgtacatatcgcacgaagatgcggagggcgtcctgcttcactaccggacgacacgcaac
ggcttctgcccttacttaattggtcagctgcaccagatagcgcacgacttctacgggatt
caattggcggtggaggagctgcctaaaacgcctttcaacaaagaggagggttatcagttt
cggttccgactcaacttcgataaccgcgactacatgactggtcgttcggcctgcaacggc
agtttggagctgggtcggataaatatctccagtcgcggaagcgtcagcacaacggcgtcg
gaaaaggccctggcgtcgctctcctccagcatcctgatgcagctcttccccttcaccttg
gttttccgtccagatctccagattatcgcggtcggccggcaattgaagcaaatgtttcca
gacaatgcgcttgtcggccaagcgctgcctgatgtcgccagagtacgccgacccaagctc
cttttcacatgggacaacttgtacagcctccaaaaagtgttgtgcgaaatggagttgctg
ccagcgatccgaacggcaaggaaaaacgcgcgccacttggctgcctccaaagcggattca
aatgcggtggccaataaagaagcgaaagaggaaaatcgacgtcttatgctgcagggacag
ttacgctatctgtcggactggaacgcaatgattttcctttgcaatcctttaataaacaac
ttggaagacatggacggaatgggtttgacaattaacgatctcagccttcacggacatggc
agggacatggtgatggccggatggcagcacaactcacggctggaagatatgtacgagcgg
gccgaagagcgatcgcaacagctccagcaaacatacgaactgcaagacgagtggaaaaaa
cgcggagacaaacttttgtactccatgatcccgcaatcagtggccgacattttgcgtagc
ggcaccgacccagttgacacttgtcaagcattcgagagcatcacagtcttgtttgtagaa
ttagccaacatcgacgaaatcacagccactaatccgatggaggcggtcagctgcatgaac
gcagttttctcgtgctttgataacattatcgaccaacataacgtctacaaggtggagacg
gtgggaaaggtgtacatggtcgttggcggagcgccagaaacaaacgaaacccacgtcaaa
gatgttgccatgggtatattgcaaatggtgaaagatacaaaaatgtctgttcacatacga
ataggtttccataccggttcggcggtagccggtgtagttggaaagaaaatgcctcgttat
tgtttttttggagacacaatcaacactgctgcacgaatgcaaaccacaagcttgcctggg
aaaatccacatctctcaaaactccttttgtcgcttgcacaactttaacggatttgtattc
gagatgcgtggaacggtattcgtcaagggcaaaggagatatgaagactcactggttgctg
agataccaagtgcccgatgggaattcgacatga

DBGET integrated database retrieval system