KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_334303Help
Entry
DAPPUDRAFT_334303 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
dpx  Daphnia pulex (common water flea)
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DAPPUDRAFT_334303
Enzymes [BR:dpx01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     DAPPUDRAFT_334303
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase HIT DcpS_C
Motif
Other DBs
NCBI-ProteinID: EFX64342
JGI: Dappu1_334303
UniProt: E9HV92
Position
Unknown
AA seq 443 aa AA seqDB search
MTDSSKPSLIAIVQMTATSNKADNFAVTKEKIEEASSLGAKVVFLPEACDYIADSHAQSL
ELAENMDGTLIKNYSELAVQNRIWISIGGFHNKSSSIDKMFNTHVLINSDGQIAGRYDKT
HLFDVEIPEKKIKLKESDYIEKGGSIASPVESPVGKIGLGICYDVRFPEFSLSLARMGAD
IITYPSAFTVATGLAHWESILRARAIETQCFVVAAAQTGIHNSKRSSYGHAMVIDPWGTV
IAQCREGTSLALAAIDLEYLRKVRREMPVFTHRRQDVYQLPTCGVLPVSPLPPDEATFNF
GQVTIKGWAVFYQSRHSLAFVNRKCVVPGHVLVMPLKASRRIPDMQPDELSDLFLTSQIV
QRGMELFHGVSSSNVAVQDGPDAGQSIQHVHVHILPRRPKDFKENDQVYDELNNHDKGPN
VEWRQEEEMKREATELRLFFAKL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattcaagtaagccatctttaattgccattgtacaaatgacggcaacatcaaac
aaggccgacaattttgccgttaccaaagagaaaattgaggaagctagtagccttggtgcc
aaagtagtttttctgccagaagcatgtgattacatcgctgattcccacgctcagtcactt
gagcttgccgagaatatggatggaaccttgatcaaaaactattcagaacttgcagtgcaa
aatcggatatggatttcaattggtggattccacaacaaaagcagttcaattgataaaatg
ttcaacactcatgtgctcatcaattcggatgggcaaatagccggtcgttacgacaaaact
cacttgtttgacgttgaaattccggagaagaaaatcaaattgaaagagtcggactacatt
gagaaaggaggatcgattgcttccccggttgagtcacccgtgggcaaaatcggtttagga
atctgttacgacgtgcgatttcctgaattcagcttgtcactagctcgaatgggggccgac
atcattacttatccatcggcttttaccgtggccactgggctggcccactgggaatcgatt
ttgagagcccgagccatcgagacgcaatgctttgtcgtcgccgccgcccagacgggcatt
cacaatagcaaacgctcctcctacggtcacgccatggttattgatccttggggaacggtg
atagcacagtgtcgagaagggaccagtttagccctagctgcgatcgatttggaatatctg
aggaaagtgcgacgcgaaatgcccgttttcactcaccgacgacaagacgtctaccaatta
cccacttgtggtgtgttgccagtttcaccgctgccgccagacgaggccacattcaatttc
ggccaggtgaccatcaagggatgggcagtgttctaccaaagtcggcattctttggctttt
gtcaaccgcaagtgcgtcgttccaggacacgtgttggtgatgccattgaaagcgagcaga
cggatcccagacatgcagccagacgaattgtccgatttgtttctcacgtcgcaaatagtc
cagagaggcatggaacttttccacggcgtttcttcgtccaacgttgccgttcaagacggc
cccgatgccggacaaagcattcagcatgtccacgtccatatcctgcctcggcgcccgaaa
gatttcaaggagaacgaccaagtctacgacgaactgaacaatcacgacaaaggacccaac
gtggaatggcgccaggaagaagaaatgaagagagaagccacagagcttcgcctgtttttc
gcgaaattgtaa

DBGET integrated database retrieval system