KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_337204Help
Entry
DAPPUDRAFT_337204 CDS       T04347                                 

Definition
(GenBank) hypothetical protein
Organism
dpx  Daphnia pulex (common water flea)
SSDB OrthologParalogGFIT
Other DBs
NCBI-ProteinID: EFX62249
JGI: Dappu1_337204
UniProt: E9I181
Position
Unknown
AA seq 91 aa AA seqDB search
MSPLQCLKTEPTNQNGKLALWPVVPKELVDLFESLAEAVFIDSGESNAVLWKVFYPFLKD
VLDKICLDPRTITQKAELQIPRFPFQASLGY
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atgtcacccctgcaatgtctaaaaactgagccaactaatcagaacggaaaattggccttg
tggcctgttgtgccaaaagagttggtagatttgtttgagtccctggccgaggctgtgttt
atcgattcaggcgaatctaatgctgtcttatggaaagttttctaccctttcctgaaagac
gtcctagataaaatctgtttggacccaagaacgataactcaaaaagctgaactgcaaatt
ccccggttcccatttcaagcaagtttaggctactaa

DBGET integrated database retrieval system