KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_347223Help
Entry
DAPPUDRAFT_347223 CDS       T04347                                 

Gene name
BABO
Definition
(GenBank) putative TGF-beta receptor type I baboon protein
  KO
K04674  TGF-beta receptor type-1 [EC:2.7.11.30]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx04068  FoxO signaling pathway
dpx04144  Endocytosis
dpx04350  TGF-beta signaling pathway
dpx04933  AGE-RAGE signaling pathway in diabetic complications
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    DAPPUDRAFT_347223 (BABO)
   04068 FoxO signaling pathway
    DAPPUDRAFT_347223 (BABO)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    DAPPUDRAFT_347223 (BABO)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    DAPPUDRAFT_347223 (BABO)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dpx01001]
    DAPPUDRAFT_347223 (BABO)
Enzymes [BR:dpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     DAPPUDRAFT_347223 (BABO)
Protein kinases [BR:dpx01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR1 family [OT]
   DAPPUDRAFT_347223 (BABO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr TGF_beta_GS Activin_recp Pkinase_fungal APH LapA_dom FTA2 DUF4448
Motif
Other DBs
NCBI-ProteinID: EFX65050
JGI: Dappu1_347223
UniProt: E9HT88
Position
Unknown
AA seq 514 aa AA seqDB search
MMGGKLYFVLIVALGCWDLALALKCHCDICTAETNHTCETDGFCFTSTSLNRKTGALIHA
YRCLDRVLLYPPENPIMCHYARPLNDTFVVGCCKDYDMCNRDLKPILHVRNTTDPEIVDL
TWFGFGKWELALLIGIPIAVGILFVMILFSVRHQRRRRMINRRMVDMEHNMDSADIPILG
HNGVGAACLRDIIDMTTSGSGSGLPLLVQRSIARQIQLMDIIGKGRFGEVWRGRWRGENV
AVKIFSSREERSWFREAEIYQTVMLRHDNILGFIAADNKDNGTWTQLWLVTDYHENGSLF
DFLNRTTVDSTTMVRMALSIATGLSHLHMEILGTQGKPAIAHRDLKSKNVLVKANRTCAI
GDLGLAVRYDATVDTVDIALNHRVGTKRYMAPEVLEETINSNHFDSFKRADVYALGLVFW
EIARRCNMGGIIDEYQLPFYDVVPSDPSIEEMRKVVCVDRQRPSIPNRWQSYETLRAMSQ
LMKECWYANAAARLTALRIKKTLANLDAPEDVKN
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgatgggtggaaaactttattttgtattgattgttgctctgggctgctgggaccttgct
ttagccctcaaatgccattgtgatatatgcaccgcagagacaaatcacacatgtgaaacg
gatggtttttgctttacttcaacgtctctaaatagaaagactggagccttgattcatgcc
tacagatgcttggaccgagtgctgctgtatcctcccgagaaccccatcatgtgtcactac
gcccgccctctcaacgacacatttgtcgtcggatgctgcaaggactacgacatgtgcaac
cgcgatttgaaacccatcctgcacgtccgcaacaccacagacccggagatcgtcgatttg
acttggttcggctttggcaagtgggagctggcgctgctcattggcattcccatcgccgtc
ggcatcttattcgtcatgatcctgttcagcgtgaggcatcagcggcgacgacggatgatc
aaccgccgcatggtcgacatggagcataatatggattcggccgacatacccattctagga
cacaacggcgtaggagccgcctgcctcagagacataattgacatgacaaccagcggctcg
ggttccggcttacccttgctcgtccagcgcagtattgcccgtcaaattcaactgatggac
ataatcggcaaaggcagattcggagaggtgtggcgtggaaggtggcgcggtgagaatgtg
gccgtcaagattttctcgtccagggaggagcgctcttggttccgcgaagctgaaatctac
caaacggtcatgctccggcacgataacattcttggtttcattgccgccgataacaaagat
aacggaacttggactcaattgtggctcgtcaccgactaccacgaaaatggatcgctcttc
gacttcctcaaccggacgacggtggacagcacgacgatggtgaggatggccctttccatc
gccactggactctctcaccttcacatggaaattctgggcactcaaggtaaaccggccatc
gctcatcgcgatctcaaatccaaaaacgttttggtcaaggccaatcgcacctgcgccatt
ggcgatttgggtctggccgtccgctacgatgccaccgtcgacactgtcgacattgccctc
aaccacagggtgggcaccaaacgttacatggcccccgaggttctcgaagaaacaatcaac
tccaaccactttgactcgtttaaacgtgccgatgtctacgctctgggtctcgtcttttgg
gagattgcccgtcgctgcaacatgggcggcatcatcgacgagtaccagttgccgttctac
gacgtcgtcccctctgacccgtccatcgaagaaatgcgcaaggtcgtctgcgtcgaccgc
cagagaccgtcgattcccaaccggtggcaatcgtacgaaacccttcgggccatgtcgcag
ctaatgaaggagtgctggtacgccaacgcagctgcccgtctaacagctctccgcatcaaa
aagacgctggccaatttggatgccccggaggatgtcaagaattaa

DBGET integrated database retrieval system