KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_4146Help
Entry
DAPPUDRAFT_4146   CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K01988  lactosylceramide 4-alpha-galactosyltransferase [EC:2.4.1.228]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx00601  Glycosphingolipid biosynthesis - lacto and neolacto series
dpx00603  Glycosphingolipid biosynthesis - globo and isoglobo series
dpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    DAPPUDRAFT_4146
   00603 Glycosphingolipid biosynthesis - globo and isoglobo series
    DAPPUDRAFT_4146
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:dpx01003]
    DAPPUDRAFT_4146
Enzymes [BR:dpx01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.228  lactosylceramide 4-alpha-galactosyltransferase
     DAPPUDRAFT_4146
Glycosyltransferases [BR:dpx01003]
 Glycan extension
  P blood group
   DAPPUDRAFT_4146
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gb3_synth Gly_transf_sug Caps_synth TcdA_TcdB
Motif
Other DBs
NCBI-ProteinID: EFX87256
JGI: Dappu1_4146
UniProt: E9FZJ1
Position
Unknown
AA seq 271 aa AA seqDB search
RQACAVESLAFHNPNLTVNVLFMVDDGHHQKQNQSKVMIKTMEKLREKYLNVQFIVADLG
EYLAGTLLEKWYHCTDWRTGPYHVAHLSDGLRLLTLHKYGGYYFDLDVILVRPVTFYRNF
VAAESGSEFGNSVIHADYGHPIMQLAVNDFPSNYNKNAWAHNGPDLLMRVMKTYCREENF
NAINYVSCRGFGALPNSTFSPIHWSNWRSFFSQRPANETGAPGWITKQVVGVHVWNKLSF
NETAYKNSTQEYVRLVRDNCPVIYSIAPERF
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
cgccaggcctgcgccgtcgagtcgctggcctttcacaatccaaatttgactgtcaacgtc
cttttcatggtggacgacggccatcatcagaaacaaaaccaaagcaaagtgatgattaaa
actatggaaaagttgagggaaaaatatttaaatgtccaattcatcgttgccgatttgggc
gagtatctggccggaactctgctggagaaatggtaccactgcaccgactggcggacaggg
ccctaccacgtcgcccacctgagcgacggcctgcgcttgctgactctgcacaagtacggt
ggatattatttcgacctggacgtcatcctagtccggcccgtcaccttttaccgcaacttt
gtggccgccgagtcgggcagcgaattcggcaacagcgtcattcacgccgactacggacat
cccattatgcaactggccgtcaacgacttcccctccaattacaataaaaatgcatgggcg
cacaacggacctgatttgttaatgcgggtcatgaaaacctattgcagagaagagaatttc
aatgcgatcaattacgtcagttgccgagggtttggtgccctgccgaactcgacgttttct
cccatccactggagcaattggcgatcgtttttcagccaaaggccggccaatgaaaccgga
gcgcccggttggatcaccaaacaagtcgtcggcgtccacgtttggaacaaattgagtttc
aacgaaacggcctacaagaattcgacgcaggaatacgtccggctggtcagagacaattgc
cccgtcatctactccatcgctcccgaaagattt

DBGET integrated database retrieval system