KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_4188Help
Entry
DAPPUDRAFT_4188   CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K04360  neurotrophic tyrosine kinase receptor type 2 [EC:2.7.10.1]
Organism
dpx  Daphnia pulex (common water flea)
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dpx01001]
    DAPPUDRAFT_4188
Enzymes [BR:dpx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     DAPPUDRAFT_4188
Protein kinases [BR:dpx01001]
 Receptor tyrosine kinases (RTK)
  TRK family [OT]
   DAPPUDRAFT_4188
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase YrbL-PhoP_reg
Motif
Other DBs
NCBI-ProteinID: EFX87321
JGI: Dappu1_4188
UniProt: E9G0Z0
Position
Unknown
AA seq 243 aa AA seqDB search
VAVKVLKAAAGPAAQEDLLQEAEIMVSFSHPNILSLKGIPNIGPWLVFEYMALGDLAQLL
RSANGNLFAKTKTAHCLNQEDLHSIAAQIADGMAYLSSQHFVHRDLACRNCLVGERPRGG
GLAVKISDFGMSRDVYTCDYYKIGGSRMLPVRWMAPESILYGKFTLESDVWSFGVVLWEV
FALGVQPYYGHSNEQVVKLILQGILLTPPSSAPPLICQLLNGCWKTQPGDRLTFAEIHSK
LKR
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
gtggctgtcaaagttttaaaagccgcagctggaccagctgcccaggaggatttgctccag
gaagctgaaattatggtttccttctctcatccaaacatcctctcgctcaaagggatcccc
aatattggaccttggctcgtgttcgagtacatggcgctgggagatctggcccagcttcta
cggtccgccaatggcaatctatttgccaaaaccaaaactgcgcattgtttgaatcaggag
gatctgcactcgatcgcggcgcaaatcgcagacgggatggcctatctctcgtcgcagcat
ttcgtccatcgcgacttggcgtgccgcaattgtctggtgggtgaacgaccccgaggcggc
ggtctggccgtcaaaatctccgatttcggaatgagccgtgacgtttacacttgcgattat
tacaagattggaggttctcggatgctgccggtgcgatggatggctcccgaatcgatcctc
tacggtaaattcacgctagaatcggatgtctggagtttcggcgtcgtcctgtgggaggtc
tttgccctaggggtacagccctactacggccattcaaacgaacaggtcgtcaaactgatc
ctacaagggatcctcctgactcctccttcttcagccccgcccctcatttgccagttgcta
aacggttgctggaaaacacagccgggggatcggctaacgttcgccgaaatccattccaag
ttaaagcgt

DBGET integrated database retrieval system