KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_64728Help
Entry
DAPPUDRAFT_64728  CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx00010  Glycolysis / Gluconeogenesis
dpx00562  Inositol phosphate metabolism
dpx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DAPPUDRAFT_64728
   00562 Inositol phosphate metabolism
    DAPPUDRAFT_64728
Enzymes [BR:dpx01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     DAPPUDRAFT_64728
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     DAPPUDRAFT_64728
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: EFX66408
JGI: Dappu1_64728
UniProt: E9HPA7
Position
Unknown
AA seq 362 aa AA seqDB search
MPILRDAVIQNHLSGRGELCAKDLQNLRDWTIDIPPELEEKLAPSGEEEMHDIGQRYTAR
LPGLLDRSYKDSDYTFRFTTASRAEKSCHHFAKGVWGKTEESTIVYPEPIENDPLIRFYK
VCSKWYDEVDNNTASRVEWQKFIDGPEVAQTVAAVSKRLGFSTSTPLSYVSLTYTMCRYD
KALYYGQLSPWCAAFANSDLLVLEYIDDLLYYYKDGYGYDINWMQACNPVVDVATYFNSI
VLGATSKPYGVFYFSHSGAMAKLLARWGLYKDAMAPTASNFAYMSGRQWSTSRMQNFGVN
MVFVLFRCELNTYKVQLYVNERLTHIPGCAGDTCLFSEFAAIVQPIIETCDLDAICENPP
TY
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcctgagagatgccgtcatccagaatcacctgagcggcaggggcgaattgtgc
gccaaggacctgcagaacctgcgcgactggaccatcgacatcccgcccgagttggaggag
aaattggcgccctccggcgaagaagagatgcacgacattggccagcgctacacggcccgt
ttgcctggcctgctcgaccgctcctacaaggacagcgattacacgtttcgattcacgacg
gccagccgggcggagaagagctgccatcatttcgccaaaggcgtttggggtaagaccgag
gagagcacgatcgtctatccggagcccatcgaaaatgatcctctcatccggttttacaag
gtgtgcagcaagtggtacgacgaggtggataacaacacggcatctcgcgtcgagtggcag
aaattcatcgacggtcccgaagtggcccagacggtggccgccgtctccaagcgcctcggc
ttctccaccagcacccccctctcttacgtgtctttgacctacaccatgtgtcgctacgac
aaggccctctactacggccaactgtcgccgtggtgcgccgccttcgccaattcggacctg
ctggtcctcgagtacatcgacgacctgctctactattacaaggacggctacggttacgac
atcaactggatgcaggcctgcaatccggttgtcgacgtggccacctacttcaattccatc
gtcttgggggccactagcaaaccatacggcgtcttctacttttcccattcgggcgccatg
gccaaactgctggcccgttggggcctctacaaggacgccatggccccgacggcttccaac
ttcgcctacatgtcgggccgtcagtggagcacgtcgcggatgcagaatttcggcgtcaac
atggtcttcgtcctcttccgctgcgagctcaacacctacaaggtgcagctgtacgtcaac
gagcggctgacgcacattcccggctgtgccggcgatacttgtctcttctccgaattcgcc
gccatcgtccagcccatcatcgaaacctgcgacttggacgccatctgcgaaaatccgccc
acctattaa

DBGET integrated database retrieval system