KEGG   Daphnia pulex (common water flea): DAPPUDRAFT_70042Help
Entry
DAPPUDRAFT_70042  CDS       T04347                                 

Definition
(GenBank) hypothetical protein
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
dpx  Daphnia pulex (common water flea)
Pathway
dpx00020  Citrate cycle (TCA cycle)
dpx00620  Pyruvate metabolism
dpx01100  Metabolic pathways
dpx01200  Carbon metabolism
dpx01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dpx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DAPPUDRAFT_70042
   00620 Pyruvate metabolism
    DAPPUDRAFT_70042
Enzymes [BR:dpx01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     DAPPUDRAFT_70042
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 RnfC_N NQRA HlyD_D23 PYNP_C
Motif
Other DBs
NCBI-ProteinID: EFX61261
JGI: Dappu1_70042
UniProt: E9I420
Position
Unknown
AA seq 719 aa AA seqDB search
HVLENQKFLTGTLDTYFIDEHPELFQFVPSQNRAQKLLNYVGDVLVNGPLTPLGTDLKPA
DVEPKVPPVDSGRQLSGFREIITEQGPEAFAKAVRNHKGLLLMDTTFRDAHQSLLATRVR
THDLLKVSPYVAQNFSSLYSLENWGGATFDVAMRFLHECPWERLEEMRRVMPNIPFQMLL
RGANAVGYTSYPDNVVYKFCELAVQTGMDIFRVFDSLNYLPNMMLGIDAVGKAGGVVEAA
ISYSGDISDPSRTKYTLPYYLDLADELVKAGTHVLCIKDMAGLLKPRAATMLIDGIRQRH
PDVPIHVHTHDTSGAGVASMLAAAQAGADVVDVAVDSMSGMTSQPSMGAVVASLQGSELD
TGISLESVSDYSAYWEQARTLYAPFECCVTMKSGNADVYLNEIPGGQYTNLQFQAYSLGL
GNQFEDVKKAYREANQLLGDIIKVTPSSKTVGDLAQFMVQNKLSGQDVLDRAEELSFPKS
VVEFMQGYLGIPYGGFPEPFRTRVLKGMPKVEGRPGASMPSMDLDKLKEDLIEAHGNQIR
DVDVMSAAMYPSVCKEYLEFRSKYGPVDKFATRIFLTGPKVGEEFEVTIEKGKTLHIKTL
AMAEDLTKTGDREVFFELNGQLRSVFIRDNTAAKELHIHPKAEKGVKGSVGAPMPGTVID
LRVKAGDKVEKGQPLVVLSAMKMEMVVQSPCTGTVKTVDIAKDMKLEGDDLLLTIEESK
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
cacgtcttggagaatcaaaagtttctaacgggcaccctggacacttactttatcgacgag
catcccgagctgttccagtttgttccgtctcagaatcgcgcacaaaagttgctcaactac
gtcggcgacgtcctggtcaacggcccgctcaccccgctgggcaccgatctcaaaccagcc
gacgtggaacccaaagtccctccggtcgattccggccgccaactgagcggattccgcgaa
atcattacggagcaaggcccggaagcctttgccaaagccgtccgcaaccacaagggtctc
ctgctgatggacacgactttccgtgacgcccaccagtctctgctggccacccgagtccgc
acgcacgacctgctcaaagtctcgccgtacgtggcccagaatttctcgtcgctctacagt
ctggagaattggggcggcgccacgttcgacgtggccatgcggttcttgcacgagtgcccg
tgggagcgattggaggagatgcgacgcgtcatgccaaacattccattccagatgctgttg
cgcggggccaatgccgtcggctacaccagttacccggacaatgtcgtctacaagttttgc
gaactcgccgttcaaacaggaatggacattttccgagtctttgattccctgaattatttg
cccaatatgatgttgggcatcgatgccgtcggcaaggccggcggtgtggtggaagcggcc
atttcttactctggtgatatttcggacccgtcaaggaccaagtacaccctgccttattat
ttagatctagccgacgagttggtcaaggccggcactcacgtcctctgcatcaaggacatg
gctgggcttctcaagcctcgggcggcgaccatgctgattgacggcatccgccaacgtcat
ccggacgttcccatccacgtccacacgcacgacacttctggcgccggagtcgcctcgatg
ctggccgctgctcaagccggagctgacgttgtcgatgtggctgtcgattccatgtcgggc
atgaccagccagccgtccatgggcgccgtcgtggccagtctgcagggctccgagttggac
acgggcatttcgctcgagtccgtcagcgactattcggcctattgggagcaggcccgcacg
ctctacgccccgtttgaatgctgcgtcaccatgaagtcgggcaacgccgacgtctatctc
aatgagatcccaggcggccagtacaccaacttgcagttccaggcctattctctcggactg
ggcaaccaatttgaggacgtcaagaaagcctacagggaggccaatcaactccttggcgac
atcatcaaagtcactccgtccagcaaaacggtcggagacttggcccagtttatggtccag
aataagttatctggccaggacgtcctggatcgcgccgaggagctcagcttccccaaatcg
gtggttgaattcatgcagggatatttggggattccgtacggaggattccccgagccgttc
cgcactcgagttctaaaaggcatgcccaaggtcgagggccgtccaggagcctcgatgccg
tccatggacctggacaaattaaaggaagatttgattgaagcccatggcaatcagatccgc
gatgttgacgtcatgtcggccgccatgtacccgtccgtctgcaaagaatatctcgagttc
cgctccaagtacggtccggtcgacaaattcgcaacgcgcattttcctcaccggccccaaa
gtcggcgaggaatttgaagtgaccattgagaagggcaagacgttgcacatcaaaactttg
gccatggccgaagatttgaccaaaaccggcgaccgcgaagttttcttcgagctcaacggc
caattgcgctccgttttcatccgcgacaatacggcggccaaggaactgcacattcatccc
aaggcggagaaaggcgtcaaaggctcggtgggagctccaatgcctggaacggtgattgat
ctcagagtgaaagccggcgataaagtcgaaaagggacaaccactggttgttttatcggcc
atgaaaatggaaatggtcgtccagtctccttgcacaggaaccgtgaaaacggtggacatc
gccaaggatatgaaacttgaaggcgacgacttgctcctgaccatcgaagagtcgaaataa

DBGET integrated database retrieval system