KEGG   Diaphorobacter polyhydroxybutyrativorans: BA022_05680Help
Entry
BA022_05680       CDS       T04937                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dpy  Diaphorobacter polyhydroxybutyrativorans
Pathway
dpy00071  Fatty acid degradation
dpy00072  Synthesis and degradation of ketone bodies
dpy00280  Valine, leucine and isoleucine degradation
dpy00310  Lysine degradation
dpy00362  Benzoate degradation
dpy00380  Tryptophan metabolism
dpy00620  Pyruvate metabolism
dpy00630  Glyoxylate and dicarboxylate metabolism
dpy00640  Propanoate metabolism
dpy00650  Butanoate metabolism
dpy00900  Terpenoid backbone biosynthesis
dpy01100  Metabolic pathways
dpy01110  Biosynthesis of secondary metabolites
dpy01120  Microbial metabolism in diverse environments
dpy01130  Biosynthesis of antibiotics
dpy01200  Carbon metabolism
dpy01212  Fatty acid metabolism
dpy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dpy00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BA022_05680
   00630 Glyoxylate and dicarboxylate metabolism
    BA022_05680
   00640 Propanoate metabolism
    BA022_05680
   00650 Butanoate metabolism
    BA022_05680
  Lipid metabolism
   00071 Fatty acid degradation
    BA022_05680
   00072 Synthesis and degradation of ketone bodies
    BA022_05680
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BA022_05680
   00310 Lysine degradation
    BA022_05680
   00380 Tryptophan metabolism
    BA022_05680
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BA022_05680
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BA022_05680
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BA022_05680
Enzymes [BR:dpy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BA022_05680
Exosome [BR:dpy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BA022_05680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: ASI68112
Position
complement(1255822..1257000)
Genome map
AA seq 392 aa AA seqDB search
MEDIVIVSAVRTPVGKFGGALAKTPATDLGAIVIREALARARVAPEQVGEVIMGQVLAAG
CGQNPARQAMMKAGLAQETPALTINAVCGSGLKAVMLAAQAVATGDSEIVVAGGQENMSL
APHVLNGSREGQRMGDWKLVDTMIVDGLWDVYNQYHMGITAENVARQHGITREMQDALAL
ASQQKAAAAQDAGRFTDEIVPVTLAQKKGDPVIFAADEYLNRKTSAEALAGLRPAFDKAG
SVTAGNASGINDGAAAVVVMSATKAAALGLQPLARIAAYGTSGLDPATMGMGPVPASRKT
LQRAGWSVGDVDLFELNEAFAAQACAVNKELGIDPAKVNVNGGAIAIGHPIGASGCRVLV
TLLHEMQRRDARKGLAALCIGGGMGVSMALAR
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atggaagacatcgtcatcgtttccgccgtgcgcacgcccgtgggcaagtttggcggcgca
ctggccaagacccccgcgaccgatctgggcgccatcgtcatccgcgaggcgctggcacgc
gcccgcgtcgcccccgagcaggtgggcgaggtcatcatgggccaggtgcttgcggccggc
tgcggccagaacccggcccgccaggccatgatgaaggcggggctggcccaggagacgccc
gcgctcaccatcaacgccgtgtgcggctcgggtctcaaggctgtgatgctggccgcccag
gccgtggcgacgggcgacagcgagatcgtcgtggctggcggccaggagaacatgagcctg
gcaccgcacgtgctcaatggctcgcgcgaaggccagcgcatgggcgactggaagctggtc
gacaccatgatcgtcgacggcctgtgggacgtgtacaaccagtaccacatgggcatcacg
gccgagaacgtggccaggcagcacggcatcacgcgcgagatgcaggatgcgctggccctg
gccagccagcaaaaggccgccgccgcccaggacgcagggcgcttcacggacgagatcgtg
cctgtgacacttgcgcagaagaagggcgaccccgtcatattcgcggcagacgaatatctc
aaccgcaaaaccagtgccgaagctctggctggcctgcgccccgccttcgacaaggccggc
tcggtcacggcgggcaatgcctcgggcatcaatgacggtgcggccgccgtggtggtgatg
agtgccaccaaggctgcggccctgggcctgcaaccgctggcccgcattgcggcctacggc
accagcggactggaccccgccaccatgggcatgggcccggtgccggcatcccgcaagaca
ttgcagcgcgcgggctggagcgtgggcgatgtggatctgttcgaactcaacgaggccttc
gctgcccaggcgtgcgcggtgaacaaggagctcggcatcgatcccgccaaggtcaacgtg
aatggcggcgccatcgccatcggtcaccccatcggtgcctcgggctgccgcgtgttggtg
accctgctgcacgaaatgcagcgccgcgatgccaggaagggcctggccgcgctgtgcatt
ggtggaggcatgggcgtgtccatggcattggcgcgttaa

DBGET integrated database retrieval system