KEGG   Diaphorobacter polyhydroxybutyrativorans: BA022_13155Help
Entry
BA022_13155       CDS       T04937                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
dpy  Diaphorobacter polyhydroxybutyrativorans
Brite
KEGG Orthology (KO) [BR:dpy00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    BA022_13155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: ASI69397
UniProt: A0A2Z2LPF6
Position
2883400..2883807
Genome map
AA seq 135 aa AA seqDB search
MPKYQFQVEVQPQYLPDQSAPDEGVYSFAYTITITNTGDVTAQLISRHWIISDANGHTEQ
VKGLGVVGQQPLLKPGEAFQYTSGCRLRTASGSMHGSYFCVAEDGEPFTCPIELFVLEAF
SPGQPGQPMAARVLH
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaataccagttccaggtggaggtgcagccgcagtaccttcccgaccagtccgcg
cccgacgaaggcgtatacagctttgcctacaccatcacgatcaccaacacgggcgacgtg
accgcgcagctgatttcacgccactggatcatctccgatgccaatggccacaccgagcag
gtcaagggcctgggcgtggtgggccaacaaccgctgctcaagcccggcgaggcatttcag
tacaccagcggctgccgcctgcgcaccgccagcggcagcatgcacggcagctatttctgc
gtggccgaggacggtgagccgttcacctgtccgatcgagctgttcgtgctggaggccttc
tcgcccggccaaccgggccagcccatggcggcaagggtgctgcattga

DBGET integrated database retrieval system