KEGG   Diaphorobacter polyhydroxybutyrativorans: BA022_13745Help
Entry
BA022_13745       CDS       T04937                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
dpy  Diaphorobacter polyhydroxybutyrativorans
Pathway
dpy00970  Aminoacyl-tRNA biosynthesis
dpy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BA022_13745
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:dpy03029]
    BA022_13745
Enzymes [BR:dpy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BA022_13745
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BA022_13745
Mitochondrial biogenesis [BR:dpy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BA022_13745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: ASI69509
UniProt: A0A2Z2LLN9
Position
2991237..2992739
Genome map
AA seq 500 aa AA seqDB search
MSNTPSSELHDLGIAQLTSALRSKQVSAVEAAQHFLARAHPHQNLGAYVAMNEDATLAQA
RAQDAALAAGTAAPLAGVPIAHKDIFVTRDFPSTAGSKMLAGYQSPFDATVVTRLADAGC
VTLGKLNCDEFAMGSANENSAVAPVGCDAPAPVRNPWDTSRIPGGSSGGSAVAVAARLAP
AVTGTDTGGSIRQPASFCGVTGIKPTYGRASRYGMIAFASSLDQAGPMARSAEDCALLLS
AMCGPDPDRDSTSLDVPAEDFSAKLNDSIDGLRIGIPAEFFGDGLAGDVRAAVDAALKEY
EKLGAKLVPISLPRTELSIPVYYIIAPAEASSNLSRFDGVKFGHRAKDYADLVDMYKKTR
AEGFGDEVKRRIMIGTYVLSHGYYDAYYLQAQKIRRMIADDFQNAFKDCDLIAGPVAPSV
AWKLGEHGNDPLADYLADIFTLPASLAGLPGMSVPAGFGAGGMPVGLQLIGNYFQEGRLL
NAAHRLQQATDFHLRAPEGI
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacaccccctcctccgaactccacgacctgggcatcgcacagctgaccagcgca
ctgcgcagcaaacaggtctcggccgtcgaggccgcgcagcatttcctggcccgcgcacac
ccgcaccagaacctgggcgcctacgtcgccatgaacgaggacgccaccctggcgcaggcc
cgcgcgcaggacgcggccctggccgccggcacggctgccccgctggccggcgtgccgatc
gcgcacaaggacatcttcgtcacccgcgacttccccagcaccgccggctcgaagatgctg
gccggttaccagtcgccgttcgacgccactgtggtcactcgcctggccgatgccggctgc
gtaaccctgggcaagctcaactgcgacgagttcgccatgggctcggccaacgaaaactcc
gccgtggcgcccgtgggctgcgacgcccccgcaccggtgcgcaacccctgggacaccagc
cgcatccccggcggctcctcgggcggcagcgccgtggccgtggccgcgcgcctggcgccg
gccgtcaccggcacggacaccggcggttccatccgccagccggcatcgttttgcggcgtc
accggcatcaagcccacctacggccgcgccagccgctacggcatgatcgccttcgcctcc
agcctggaccaggctggcccgatggcccgctcggccgaggactgcgcgctgctgctgtcg
gccatgtgcggccccgaccccgaccgcgactccaccagcctggacgtgccggccgaggat
ttcagcgccaagctgaatgactccatcgacggcctgcgcatcggcatcccggccgagttc
ttcggcgacggcctggcgggcgacgtgcgcgccgccgtcgatgcggcactcaaggagtac
gagaagctgggcgcaaagctggtgcccatcagcctgccgcgcacggagctgtcgatcccc
gtgtactacatcattgcgccggccgaggcgtcgtccaacctctcgcgctttgacggcgtg
aagttcggccaccgcgccaaggactacgccgatctggtggacatgtacaagaagacccgc
gccgaaggcttcggcgacgaggtcaagcgccgcatcatgatcggcacctacgtgctctcg
cacggctactacgacgcctactacctgcaggcgcagaagatccgccgaatgatcgcggac
gacttccagaacgccttcaaggattgcgacctgatcgccggccccgtggcgcccagcgtg
gcctggaagctcggcgagcacggcaacgacccgctggccgactacctggccgacatcttc
accctgcccgcgtcgctggccggcctgcccggcatgagcgtgcccgccggctttggcgcg
ggcggcatgcccgtgggcctgcaactcatcggcaactacttccaggagggccgcctgctg
aacgccgcgcaccgcctgcagcaggcgaccgacttccacctccgtgcgccggagggcatc
tga

DBGET integrated database retrieval system