KEGG   Diaphorobacter polyhydroxybutyrativorans: BA022_13980Help
Entry
BA022_13980       CDS       T04937                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
dpy  Diaphorobacter polyhydroxybutyrativorans
Pathway
dpy00480  Glutathione metabolism
dpy00590  Arachidonic acid metabolism
dpy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:dpy00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    BA022_13980
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BA022_13980
Enzymes [BR:dpy01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     BA022_13980
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: ASI69550
UniProt: A0A2Z2LKA8
Position
3037364..3037849
Genome map
AA seq 161 aa AA seqDB search
MTTAYDFDATRIDGTPQPLSDFRGQVLLIVNTASACGFTPQFTGLQALHERYGPRGLVVL
GFPCNQFGHQDPGSNDAIAGFCQRNYGVQFPMMSKIDVNGSDAHPLYRWLTAEAPGVLGT
KAIKWNFTKFLVGRDGQVIRRYAPQEAPEKLTVDIEAALAA
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgaccactgcgtatgacttcgacgcgacacgcatcgacggcacaccccagccactgagc
gacttccgcggtcaggtgctgctcatcgtcaacaccgccagcgcctgcggcttcacgccg
cagttcaccggcttgcaggcgctgcatgaacgctatgggccgcgcgggctggtagtgctc
ggctttccgtgcaaccagttcggccaccaggacccgggcagcaacgacgccatcgcgggc
ttttgccagcgcaactatggcgtgcagtttcccatgatgtccaagatcgacgtcaacggc
agcgacgcgcacccgctgtaccgctggctcaccgccgaagcgcccggcgtgctgggcacc
aaggcgatcaagtggaacttcaccaagttcctggtcggccgggacggccaggtgatccgc
cgctacgcgccgcaggaagctcccgagaagctcacggtcgacatcgaggcagcgctggcg
gcctga

DBGET integrated database retrieval system