KEGG   Diaphorobacter polyhydroxybutyrativorans: BA022_17130Help
Entry
BA022_17130       CDS       T04937                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
dpy  Diaphorobacter polyhydroxybutyrativorans
Pathway
dpy00071  Fatty acid degradation
dpy00072  Synthesis and degradation of ketone bodies
dpy00280  Valine, leucine and isoleucine degradation
dpy00310  Lysine degradation
dpy00362  Benzoate degradation
dpy00380  Tryptophan metabolism
dpy00620  Pyruvate metabolism
dpy00630  Glyoxylate and dicarboxylate metabolism
dpy00640  Propanoate metabolism
dpy00650  Butanoate metabolism
dpy00900  Terpenoid backbone biosynthesis
dpy01100  Metabolic pathways
dpy01110  Biosynthesis of secondary metabolites
dpy01120  Microbial metabolism in diverse environments
dpy01130  Biosynthesis of antibiotics
dpy01200  Carbon metabolism
dpy01212  Fatty acid metabolism
dpy02020  Two-component system
Brite
KEGG Orthology (KO) [BR:dpy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    BA022_17130
   00630 Glyoxylate and dicarboxylate metabolism
    BA022_17130
   00640 Propanoate metabolism
    BA022_17130
   00650 Butanoate metabolism
    BA022_17130
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BA022_17130
   00072 Synthesis and degradation of ketone bodies
    BA022_17130
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BA022_17130
   00310 Lysine degradation
    BA022_17130
   00380 Tryptophan metabolism
    BA022_17130
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BA022_17130
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BA022_17130
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BA022_17130
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:dpy04147]
    BA022_17130
Enzymes [BR:dpy01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BA022_17130
Exosome [BR:dpy04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BA022_17130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ASI70107
Position
3730593..3731783
Genome map
AA seq 396 aa AA seqDB search
MSQHHDPVVIVSAARTPMGAFMSDFADLAAHDLGGAAIKAAVERAGIAPEKVDEVLFGNC
LMAGQGQAPARQAGFKGGLPQSTGAVTLSKMCGAGMEATILAHDQLIAGSRDVMVSGGME
SMTNAPYLLKKGRGGYRMGHDKVYDHMMLDGLEDAYEAGRSMGTFGEDCAVKYSFTREQQ
DAFAIESVKRAQQATQSGAFATEITPVTVKTRKGDVTVSIDEGPAKAKLDKIAGLKPAFK
KDGTITAASSSSINDGAAALVLMRQSTAQQLGCKPLAKIVAHATHSQAPEWFTTAPVGAT
QKALKKAGWKVEDVDLWEVNEAFAVVPMALMAELNVPHDKVNVHGGACALGHPIGASGAR
IIVTLIHALQRHGKKKGLATLCIGGGEGTAMAIELV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagccaacaccacgaccccgtcgtcatcgtcagcgccgcgcgcacgcccatgggcgcc
ttcatgagcgactttgccgacctcgcggcgcatgacctgggcggcgctgccatcaaggcc
gccgtcgagcgtgccggcattgcccccgagaaggtggacgaagtgctgttcggcaactgt
ttgatggccggccagggccaggcgcctgcgcgccaggcgggcttcaagggtgggttgccg
cagagcaccggcgcggtgacgctgtccaagatgtgcggcgcgggcatggaggccaccatc
ctggcccatgaccagctgatcgccggcagccgcgacgtgatggtctccggcggcatggag
agcatgaccaacgccccctacctgctcaagaaagggcgcggcggctaccgcatgggccat
gacaaggtgtacgaccacatgatgctcgacggcctggaagacgcctacgaggccggccgc
tccatgggcaccttcggtgaggactgcgccgtcaagtacagcttcacgcgcgagcagcag
gacgcctttgccatcgaaagcgtcaagcgcgcgcagcaggcgacgcaaagcggcgccttc
gccaccgagatcacacccgtaacggtcaaaacccgcaagggcgatgtgacggtgagcatc
gacgaaggcccggccaaggccaagctggacaagatcgccggcctcaagcccgcgttcaag
aaggacggcaccatcaccgccgcctccagctccagcatcaacgacggcgccgccgccctg
gtgctgatgcgccagtccaccgcccagcaactgggctgcaagccgctggcgaagatcgtg
gcgcacgctacgcattcgcaagcgcccgagtggttcaccaccgcccccgtgggcgcaacc
cagaaggccctgaagaaggccggctggaaggtcgaggacgtggacctgtgggaggtgaac
gaggccttcgccgtcgtgcccatggcgctgatggccgagctgaacgtgccgcacgacaag
gtcaacgtgcatggcggcgcttgcgctctgggccaccccatcggcgccagcggcgcgcgc
atcatcgtcacattgatccacgcgctgcagcgccatggcaagaagaagggcctggccacg
ctgtgcatcggcggcggcgaaggcacggccatggccatcgaactggtctga

DBGET integrated database retrieval system