KEGG   Dinoponera quadriceps: 106740673Help
Entry
106740673         CDS       T05610                                 

Definition
(RefSeq) serine/threonine-protein kinase PLK4
  KO
K08863  polo-like kinase 4 [EC:2.7.11.21]
Organism
dqu  Dinoponera quadriceps
Pathway
dqu04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    106740673
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:dqu01001]
    106740673
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:dqu03036]
    106740673
Enzymes [BR:dqu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.21  polo kinase
     106740673
Protein kinases [BR:dqu01001]
 Serine/threonine kinases: Other
  PLK family [OT]
   106740673
Chromosome and associated proteins [BR:dqu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    106740673
   Centrosome duplication proteins
    Regulators of centriole replication
     106740673
  Sister chromatid separation proteins
   Polo kinases
    106740673
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Plk4_PB1 Plk4_PB2 Pkinase_fungal Kinase-like Haspin_kinase RIO1 APH DUF4520 Kdo
Motif
Other DBs
NCBI-GeneID: 106740673
NCBI-ProteinID: XP_014467426
Position
Unknown
AA seq 775 aa AA seqDB search
MRPRIMPALSAGFGEHIEDYKVLNLLGKGGYGCVYRAKCLRSNTDVAIKMIDKKRMQAAG
MVARVKQEVDIHSRLKHPAILELYTCFEDTNYVYLVLELCHNGELQRFLKDQGSKTLSEE
RAARIIRQVVQGLLYLHSHQILHRDMSLANLLLTKDMQVKIADFGLATQLSRPDERHLTM
CGTPNYISPEVATKSSHGPEADVWSLGCMLYTLLVGQPPFDTDTVKSTLTRVVMADYVMP
HYLSENAKDLIDKLLKKNPEDRIRLRSIIKHPFITSIEKSRLHNERDGAGKDFLTDGMVD
SGLGRTLSSYARPRMRSRSEERMSTMPMMLNGPMVSLRSEALSEPIMKTHANYGAKYANY
CAKEDSLLQCVPFPPRVFPQNEYYDAHDSNKQKVERHKRREKSAENHNSEVTEEANTKLQ
VSPLNSNRLQPTRHRTKNAILTILDNGEVCIEFTRRRNGKEKVNEVCRISGDGLRVVLYK
PHISLEVGSQPPPLPSRGADSIYSYENLPACHHRKYMYAFRFVNLVRAKTPKLTLYTQRS
KCLFMENGPQPNCEMHFYNGVKVVREDGVVKITESSSTFVEGELPIYLENYYEHYSECYQ
HCLLLESTLTSLEAATGHPCFPVIIGRRPLNAALNDAPCMQGKENISHTANSTPVLPSFD
ASCSVVSTVASRSRKMNSTHSSNNIVDKVAVPGIGFATQFTSGNIRVDYKDGSVLTVNPQ
NHSSGITYESNNGDVMRYNKHHQQNPEIPFAVQEKLRQLPRIIEYLIQPKYKGIR
NT seq 2328 nt NT seq  +upstreamnt  +downstreamnt
atgaggccccggatcatgcccgcgttgtcggcgggcttcggcgagcacattgaggattac
aaagtgttgaatctgcttggcaaaggaggctacggctgcgtctaccgggcaaaatgtctc
cgcagcaacacggatgtcgcgatcaaaatgatcgacaagaagaggatgcaagctgctggg
atggtggctagagtgaagcaggaagtggatattcactcgcgcctaaaacacccagctatt
ttggaattatacacttgttttgaggacaccaactatgtatatctagttttagaattgtgt
cataatggagagctccaacgcttcctcaaggatcagggttccaagactttgtccgaagaa
cgcgctgcccgtataatcagacaggttgtgcaaggtttactttatctccattcccatcag
atacttcacagagatatgtcattagctaatttacttttgaccaaagatatgcaggtgaaa
atcgcggatttcggattagccactcaactgagtagaccagatgaacgacacttgactatg
tgtggcacgccaaactacatatcgcctgaagtcgcgacgaaatcttcgcacgggccggaa
gcggatgtctggagcttgggatgtatgttgtacaccttgttggtgggccagccgcccttt
gacaccgacactgtcaagagtaccttaactcgagtggtcatggctgactatgtgatgccg
cattatctgtcggaaaacgcgaaggatctgatagacaaattgctaaagaaaaatccggaa
gacagaatacgcctgcgtagcatcatcaagcatccgtttatcacgagcatagagaagagt
agactgcataacgaaagagatggcgctggcaaagacttcctgaccgacggtatggtggat
tctggactcggaagaaccttatcctcctacgcccgaccgagaatgcgatctcggtctgag
gagagaatgtccacgatgccgatgatgttgaacggtcctatggtcagcctgagaagcgag
gcgttatccgagcccatcatgaaaacgcacgcgaactacggagccaagtacgcgaattat
tgcgcgaaggaggactccttattgcagtgtgttccatttcctcccagggtattcccgcag
aacgaatattacgacgcgcacgactccaacaaacagaaagtggagaggcacaagcgaagg
gagaaaagtgcggagaatcataactcggaagtaaccgaggaggcgaacacgaagttacag
gtctcacccttgaattccaacaggctacaacccacccggcacagaacgaagaacgcgatt
ctcaccattttggacaacggagaagtctgcatcgaattcaccaggcgtagaaatggcaaa
gaaaaggtcaatgaagtgtgcaggatatcaggcgacggtctgcgagttgttctttataag
cctcacatatctctggaagtgggttcgcaaccgccaccattgcccagccgaggcgccgac
agcatttattcatacgagaatctgccggcgtgtcatcatcgtaaatacatgtacgctttt
cgttttgtgaatctggtccgggcgaagactcccaagctgacgctgtacactcagcgctcg
aagtgcctgttcatggagaacggtccgcagcccaactgcgaaatgcacttttacaacgga
gtgaaggttgtccgagaagacggtgttgtgaagatcactgagagcagctctacgttcgtt
gaaggcgagcttcctatttatctagagaattattacgagcattattccgagtgctaccag
cattgcttgctgcttgagtccactttgacatctttagaagcggctacaggtcacccctgc
tttcccgtgataatcggacgaaggcccttgaacgcggccttgaatgatgctccctgcatg
caggggaaggaaaatatctcgcacacagcaaacagtactcccgtcttgccatctttcgac
gcttcctgctccgtcgtttcgacggtagcctccaggtcgcgtaaaatgaactccacgcat
agttctaataatattgtagacaaggtagcggtgccaggtatcggttttgctacgcaattc
acatctggtaacattagggtcgattataaagatggttccgttttaaccgtgaatccgcag
aatcatagcagcggcattacatatgagagtaataacggcgatgttatgcgatacaataag
catcatcagcaaaatccggagatacctttcgcagtacaggaaaaactgcgtcaattgcca
aggatcatcgaatatctcattcaacccaaatataaaggcattcggtag

DBGET integrated database retrieval system