KEGG   Dinoponera quadriceps: 106741177Help
Entry
106741177         CDS       T05610                                 

Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase FKBP1A-like
  KO
K09568  FK506-binding protein 1 [EC:5.2.1.8]
Organism
dqu  Dinoponera quadriceps
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:dqu03110]
    106741177
Enzymes [BR:dqu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     106741177
Chaperones and folding catalysts [BR:dqu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   FKBP
    106741177
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FKBP_C
Motif
Other DBs
NCBI-GeneID: 106741177
NCBI-ProteinID: XP_014468378
Position
Unknown
AA seq 109 aa AA seqDB search
MGVDVEVLRQGDGQTFPKTGQRVVVHYTGTLVDGKQFDSSRDRGVPFTFRIGKGLVIKGW
DEGIAQMCVGERARLTCSPDFAYGSTGHPGIIPPNAVLIFDVELLKVEP
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtggatgtcgaggttctccgacagggagatggtcaaacttttccaaagacagga
caaagggtggttgttcactatacaggtacccttgttgacgggaagcaatttgactccagt
agagaccgtggtgtaccgtttacgttcagaattgggaaaggcttagtgatcaaaggctgg
gacgaaggtatcgcgcaaatgtgcgttggagagcgagctaggttaacttgttctccagat
tttgcttatggtagcacaggccatcctggaattattccaccaaatgctgttctcatcttc
gacgtggaattgttgaaggtggagccctga

DBGET integrated database retrieval system