KEGG   Dinoponera quadriceps: 106741497Help
Entry
106741497         CDS       T05610                                 

Definition
(RefSeq) probable low-specificity L-threonine aldolase 2
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
dqu  Dinoponera quadriceps
Pathway
dqu00260  Glycine, serine and threonine metabolism
dqu01100  Metabolic pathways
dqu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:dqu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    106741497
Enzymes [BR:dqu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     106741497
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Pyridoxal_deC
Motif
Other DBs
NCBI-GeneID: 106741497
NCBI-ProteinID: XP_014469091
Position
Unknown
AA seq 387 aa AA seqDB search
MSTYGGINENIEDYAQEKDAIIVDLRSDTITKPTETMRLSMFLACVGDDVYEEDPTVKEL
QKMAAELLGKEDALFVSTGTMGNLIAIMNHCDVRGSEVYCGDKSHVFQHEQGGAAQLAGV
SLYVLPNNNDGTFDLKKLEGAIRSDRLHEPISKLVIVENTINGIIVPQLWVEELTAVARR
HDLRMHLDGARLWNASVASKISAKDLAAPFDSVTFCLSKGLGAPVGSVLCGSKSFIANAR
RRRKVLGGGMRQVGVIAAAGLVALEDSIPLLEEDHQRALTIAQAINEMNSKVFTVDMRSV
QTNMIFVDVNSERISAVDFMKRLHQVERPDEDDRIIIRCLALTNKLIRIVLHYDINDPMM
YSAIRKLKYVIKEMTTLHGDDSKSPEN
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtccacatatggcggtatcaacgagaatattgaagattacgcgcaggaaaaggatgcc
atcatagtcgacttacggagcgatacgattacaaaaccgacggaaacaatgagactgtcc
atgtttctagcgtgtgtgggagacgatgtctatgaggaagatcctacagtgaaagaatta
caaaaaatggccgcggaattacttggaaaagaagacgcgttgttcgtcagtaccggtacg
atgggaaatttgatagctatcatgaatcactgcgacgtgcgcggcagcgaagtctactgc
ggcgacaagtcgcatgtgtttcaacacgagcagggtggtgccgcgcaattagccggcgta
agcctctacgtcctgccgaataacaacgacggcacgttcgacttgaagaagctggagggc
gcgattcgcagtgatagattgcacgaaccgatctcgaaattggtgatagtggagaacacg
attaatgggataatcgtgcctcaattgtgggtggaggagttgactgcggtggcgaggagg
cacgatcttaggatgcatttggacggggcgcgattatggaacgcttcggtggcttcaaag
atctcggcgaaggatctcgcggctccgttcgactcggttaccttttgcttgagcaaggga
ttgggcgcgccggttggctccgtgctttgcggaagcaagagctttatcgccaatgcgagg
aggaggaggaaggtgctgggcggtgggatgagacaggtcggtgtaatcgccgcagccggg
ctcgtcgccctggaagactcgataccgctattagaggaggaccaccaaagagcgttgacg
atcgcgcaggcgatcaatgagatgaattccaaggtgttcaccgtagacatgagatccgtg
cagaccaacatgatattcgtggacgtcaattccgagcgcatatccgcggtggatttcatg
aagagactccatcaagtagaacggcccgatgaggatgacagaattataatccggtgtctc
gctctaaccaacaaattgatcagaatcgttcttcattacgatatcaatgatccgatgatg
tactctgctatacgcaagttaaaatacgtcatcaaagagatgacgactcttcatggagat
gactctaagtctcctgaaaattaa

DBGET integrated database retrieval system